KEGG   Monomorium pharaonis (pharaoh ant): 105834163Help
Entry
105834163         CDS       T05760                                 

Definition
(RefSeq) uncharacterized protein LOC105834163 isoform X1
  KO
K11833  ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpha01002]
    105834163
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mpha04121]
    105834163
Enzymes [BR:mpha01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     105834163
Peptidases and inhibitors [BR:mpha01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   105834163
Ubiquitin system [BR:mpha04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    105834163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1
Motif
Other DBs
NCBI-GeneID: 105834163
NCBI-ProteinID: XP_012531891
LinkDB All DBs
Position
Unknown
AA seq 1049 aa AA seqDB search
MPMTVNAEIGNHVSPFCPRAHRWRISADNLVIRRGSERGSRQEVSTKGACTFQGGISVAR
RRLQRHVDVYTHPTEKLEEEEEEEIADSQRDMSYHRSGQAGAVAVSYSTSPMAPHSPSRR
YSSGTGSGGGSSTSSGISSSTSKFTGYRSTGSSSLLDRPTSFYTSSSSSSSLRSNYISSE
YRRSYCAPGSFYPSASTGTSARRNYSSEYSRSTCSPARSVSSSTYGDTGGSNSSGTALAA
ATTIVNGTSSGTSRYIPSTSGATVNSSTSSSRERSVVVDPAADIISRYSPASYVPSIQRQ
QQAASSSNSSSSGHHHWRQHRSTSSSLNELFGGDEREVERKDLRLLESSLSSSSSSSSVA
TSAAAGLWSKSGKRRPPTSGGTVLTTGIGHARTTDSSVSLAEVTSTVDDRVTRKPDDDDD
DENDSIRDNNDDQHNNNGNTGRDGDDFACGYVGVNNNDDDDDDERDNDNDENEHGDEDED
EDVNGDDDDANLNNCRHRFHQQRRHRPDEVLLPVAKRNVLSSAAAAGGSGDLIGVSSLDL
LTNLATNPHNTELLINNNAQDKVTGGKEEVAEIAIATNDEVTRDANNVTSFVTFLQRDRR
DIPEDDDEEESNVSDGTDEIDFGRTTIDSVAGRPNGDDPSVPSTSRRTDQPGLFSATTAS
CSNLTPSPTNPSTAHQSIYRGVNEQYEGSPTNRPARSRLQALRDERCGLNGLRNIGNTCF
MNSVIQCLSNTRPLLEYLLNEQYLVDINTTTSSMKGALIKAFSQVIHELWEVGGDHVVNT
TALKSQIQRFAPRFMGYSQQDAQEFLRYLLEGLHEDVNRVTTKLPPIHGDIPDSYTDMQK
AVESWKRYIRSEDSTIVDVFVGQLRSSLRCTSCDHVSVTLDPFWDLSLPIPARSGTVKLS
QCLEHFTREEVLDGDEKPTCSKCQMRRKCTKSFSIQKFPKILVIHLKRFSPMERFRGKLN
VMVDFPLTGLDLSAFAAPRVPGCTYNLYGVANHSGTTYSGHYTAYCKHPYSGEWHEYNDS
RVSVVSTRSVVSSEAYVLFYEQQPHSSHL
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgactgtcaacgcggaaatcggcaaccacgtatcgccattttgtccgcgcgcg
catcgctggcgtatcagtgccgataatctcgtgatacggcgagggtcggagcgtggatcg
cgccaggaggtgtcgacgaaaggcgcttgcaccttccagggaggaatatctgtggcgagg
agacgactccagcgtcacgtagatgtgtatacgcacccgacggagaagctcgaggaggag
gaggaggaggagatcgcggactcgcagcgcgacatgtcgtaccatcgcagcggtcaggcg
ggcgccgtagcggtctcgtacagcaccagtccgatggcaccgcactcaccgagccgtagg
tactcgagcggcaccggcagcggcggtggcagctccaccagctccgggatcagcagctcg
acgtccaaattcaccgggtaccgctctaccggctcgtcctcgctcctggaccggcccacc
agcttctacacgtcgtcctcgtcgagctcgagcctgcgctccaactatatctcctcagaa
tacaggcggtcctattgcgcgccaggaagcttctacccgtcggcttctaccggcacgagt
gcccgcaggaactactcgtcggagtacagtcgatccacctgttcacctgcaaggtcagtc
tcgtcatcgacgtacggagatacgggcggcagcaacagcagcggcaccgcattggcagca
gcgacaacgatcgttaacggtaccagcagcggcactagcagatacatcccgtcgacatcg
ggcgcgaccgtcaacagttccacatcctcgtcgagagaacgcagcgtcgtcgtcgaccct
gccgccgacatcattagcaggtactcaccagccagttacgtgcccagtattcaacgtcaa
cagcaggcggcgagtagtagcaacagcagcagcagcgggcatcatcactggaggcagcac
cgttcgacgtcgtcgtcgctgaacgagttgttcggcggtgacgagcgcgaggtcgagcgc
aaggatctccgcctcttggagtcctcgctctcctcgtcgtcctcctcctcgtccgtagcc
accagcgcggcggccggtctatggtccaagtccggcaagagaaggccgcctacaagcggc
ggcacggtgctcaccaccggcattggacatgcgcgcaccacggacagctccgtgtctctc
gccgaggtaacgtccaccgtcgacgatcgcgttacccgtaaaccggacgacgacgacgac
gacgaaaacgatagtattagagacaacaacgacgatcagcataacaacaacggcaacacg
gggcgcgacggcgatgatttcgcgtgtggatacgtgggcgttaataacaacgacgacgac
gacgacgacgagcgtgacaacgacaacgacgagaacgaacacggcgacgaagacgaggac
gaagacgtgaacggcgacgacgacgacgcgaatctcaacaattgccgtcaccgcttccac
cagcagcgtcgccatcgaccagacgaggttctcttacccgtcgctaagcgtaacgttctc
tcatccgctgccgccgctggtggtagtggtgatttgattggtgttagcagccttgacctg
ttaactaacctcgccactaatcctcataacaccgagctgctgatcaataacaacgctcag
gacaaggtgacaggtgggaaggaggaggtcgccgagattgcgattgcgacgaacgacgag
gtaacgcgcgacgccaacaatgtcacgtcgtttgtcacgtttctgcaacgcgaccggcgg
gacattcccgaggacgacgacgaggaggagagcaacgtgtccgacggcacggacgagatc
gacttcggccggacaacgattgacagcgtggcgggtaggccgaacggcgacgacccgtcc
gtcccgtcgacatcgaggcgaaccgatcagcccggtctcttctctgcgactactgcgagc
tgcagcaacctgacgccgtcaccgacaaatccatccacggcgcatcaaagtatctatcgc
ggagtcaacgagcaatacgagggaagcccgactaatagaccggcgcgtagtcgtttacag
gctcttcgcgacgaacgatgtggtctaaacggcttgcggaatattggaaatacatgtttt
atgaacagcgtgatccaatgcttgagcaacacgagacctttgctagaatatctgctgaac
gaacaatacctggtcgacataaatactacgacgtccagcatgaaaggcgccctgatcaaa
gcgttcagtcaagtgattcacgaattgtgggaggtgggcggcgatcacgtggttaacacg
accgcgctcaagtctcagatacagagattcgcgccacgtttcatgggctacagtcaacag
gacgctcaagagtttctcagatacttgctggagggtttgcacgaagacgtcaacagagtc
accacaaagctaccacctatacatggcgacatacctgacagttacacggatatgcaaaaa
gcggtggagagttggaaacgatatattcgcagtgaagatagcacaatagtcgacgtattc
gtcgggcaattacgttcatctttacgttgcacttcttgtgatcacgtatcggtcaccctc
gatccgttttgggacctgagcttaccgataccagccagaagtggcacggtaaagctgagc
caatgtttggagcacttcactcgggaagaggtgttggacggcgacgagaaaccaacgtgt
tctaaatgtcagatgagaagaaaatgcaccaagagcttcagcatacagaaatttccaaaa
attttggttattcatttgaaacgtttttccccgatggaacgctttcgcggcaagctaaac
gtgatggtggactttccattaacaggtttggatctcagtgcctttgccgccccgagagtc
ccgggctgcacgtacaatttgtatggggttgcgaatcattcgggcaccacgtattccggt
cactacaccgcgtactgcaagcacccatactcgggggaatggcatgagtataacgacagc
cgagtgtccgtcgtgtcaacgcgatcggtcgtttccagtgaagcctacgtactattttac
gaacaacagcctcacagttctcacttgtaa

DBGET integrated database retrieval system