KEGG   Monomorium pharaonis (pharaoh ant): 105835031Help
Entry
105835031         CDS       T05760                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN isoform X1
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00562  Inositol phosphate metabolism
mpha01100  Metabolic pathways
mpha04068  FoxO signaling pathway
mpha04070  Phosphatidylinositol signaling system
mpha04140  Autophagy - animal
mpha04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105835031
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105835031
   04070 Phosphatidylinositol signaling system
    105835031
   04150 mTOR signaling pathway
    105835031
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105835031
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpha01009]
    105835031
Enzymes [BR:mpha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105835031
    3.1.3.48  protein-tyrosine-phosphatase
     105835031
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     105835031
Protein phosphatases and associated proteins [BR:mpha01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    105835031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DSPn
Motif
Other DBs
NCBI-GeneID: 105835031
NCBI-ProteinID: XP_012533422
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MFWELMGICFSCRRPTSGRLNSKISEHISASVTPLHVCLEEQRRPELGSCDASQAHKPQV
KRTFENQKTEEEIPEEVAESDSIEIETGELRQSQPSMANTISNMKMTNPIKGLVSKRRKR
FTEDGFNLDLTYIKANLIAMGFPAEKLEGVYRNHIDDVVKLLESKHKDHYKIYNLCSERS
YDCKKFKQRVATYAFEDHNPPKLEQIKPFCEDVQSWLSQDKDNVAAVHCKAGKGRTGVMV
CCYLLHSKQFPTATEALNYYGTKRTHDRKGVTIPSQRRYVDYYATLLQEGVSYKPVTLLL
RKIQLDPAPIFNGGQGCLHFVISESNKRIFSDDYEVRKGTSTICIPLQHTVALTGDIRVE
FYNYRPKMKRKEKMFHFWFNTFFVREKANSDCDNGELHVERSARAFSCDGTAMELPMVMS
HVKPRTGSLASLGPMPPTLVLRIDKSGLDNAHKDKNHKLYSPDFKVSLFMHSVSGNISPA
VPATTNRGGDSVQLGMGGQETPSESSEADSSECDTTGDEDGWESGESSASLVVNHQHHPL
THSSSRTHVSSLRPRCSLKETAKGLLSRGDKNRNSNRQGVSGANAKRSSAPFARSATLDT
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgttctgggaattgatgggtatatgcttttcctgcaggagacccaccagcggcaggttg
aacagtaaaatatctgagcatatctcggcctccgtaacacctctccatgtttgtctggag
gaacaaagaagaccagaactgggctcatgtgacgcctcacaagctcacaagcctcaggtt
aaaagaacctttgaaaatcaaaaaacagaagaagagattcccgaggaggtggcggagagt
gattcgatcgaaatcgagacaggagagttaagacaaagccagccgagcatggccaatact
atcagcaacatgaagatgactaatcccataaaaggacttgttagcaaacgccgcaaacgt
ttcactgaagatggttttaatcttgatctcacatatataaaagcgaatctaatagctatg
ggttttcctgctgagaagctggaaggagtgtacagaaatcacatcgatgacgttgttaag
ctgcttgaatcgaaacataaagaccattacaagatttacaatctgtgttctgaaagatcg
tacgactgtaaaaagtttaagcaaagggtggccacttacgcatttgaagatcacaatcca
ccaaaacttgaacagattaagcctttttgcgaggacgtgcagtcatggctatcccaagat
aaagacaacgttgcagcagttcactgcaaggcgggcaaaggtcgaacgggtgtgatggta
tgttgctatctacttcacagcaaacagtttcccactgccacggaagcccttaattattat
ggaactaaacggactcacgataggaaaggcgtaacaataccatcgcagagaagatatgta
gactattatgcaactctccttcaagaaggtgtcagttataaaccagtgacattattacta
cgtaaaatacaactggatccagcccctattttcaacggaggtcaaggctgtttgcatttt
gttatatcggaatccaacaaaaggatattttctgatgattacgaggttcggaaaggtaca
tccactatatgcataccattacagcacactgtcgctctgacgggagatatacgggtggaa
ttctacaactataggccaaaaatgaaacgaaaggagaagatgtttcatttttggtttaac
acatttttcgtccgtgagaaagcgaattccgactgcgacaatggcgaattacacgttgaa
aggtcggcgagggcatttagctgcgacggtacggccatggagttacccatggttatgtcg
catgtgaaacctagaactggatcattggcaagcctcggtcccatgccgcccactcttgtt
ttacggatagacaagtcgggattggacaatgcacacaaggataaaaatcacaaactatac
agtccagattttaaagtgagtctatttatgcatagcgtgagcggaaacatatcgccagct
gtgccagcgacgacgaatagaggtggcgatagtgtgcagctgggaatgggcgggcaggag
acaccgagcgagtcaagcgaggcggacagcagtgaatgtgacaccaccggcgacgaagac
ggttgggaatccggtgagtcctctgcatccctggtggtgaaccaccaacaccatcctctt
acacacagcagtagccgtacacacgttagcagtctccgtccgcgatgcagtctcaaggag
accgccaagggtctgctgtcgcgcggcgacaagaatcggaacagtaacaggcagggcgtc
tccggtgcgaacgcgaaacgttcctccgctccgttcgcgcgctcggccactctcgacacg
tag

DBGET integrated database retrieval system