KEGG   Monomorium pharaonis (pharaoh ant): 105835119Help
Entry
105835119         CDS       T05760                                 

Definition
(RefSeq) C-terminal-binding protein
  KO
K04496  C-terminal binding protein
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04310  Wnt signaling pathway
mpha04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    105835119
   04330 Notch signaling pathway
    105835119
Membrane trafficking [BR:mpha04131]
 Endocytosis
  Macropinocytosis
   Others
    105835119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 105835119
NCBI-ProteinID: XP_012533573
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MDKRKMMPKRPRMENLRGPIANGPIQTRPLVALLDGRDCSIEMPILKDVATVAFCDAQYT
SEIHEKVLNEAVGALMWHTIILTKEDLEKFKTLRIIVRIGSGVDNIDVKAAGELGIAVCN
VPGYGVEEVADTTLCLILNLYRRTYWLANMVREGKKFTGPEQVREAATGCARIRGDTLGI
VGLGRIGSAVALRAKAFGFTVIFYDPYLPDGIEKSLGLTRVYTLQDLLFQSDCVSLHCTL
NEHNHHLINEYTIKQMRPGAFLVNTARGGLVDDDALAAALKQGRIRAAALDVHENEPYNV
FQGQSANQCPLKDAPNLLCTPHAAFYSDASCTELREMAASEIRRAIVGRIPDCLRNCVNK
EYFLSSTGNGFSSRC
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacggaagatgatgcccaaacgccctcgtatggagaacttgaggggtccgatt
gccaatggaccaattcaaacacggccactggttgcacttcttgacggccgtgattgttct
atcgaaatgccaatcctcaaagacgttgcaactgttgctttttgcgatgcacaatacacc
tcagaaatacatgaaaaggtattaaatgaagcagtgggtgcattgatgtggcatacgata
attctgacgaaggaggatttggaaaaatttaaaactcttcgaatcatcgttcggattggt
tctggtgtagataacatcgacgtcaaggcagctggggaacttggcattgcggtgtgtaat
gtgcctggctatggggttgaagaagtagctgacactactctttgcctcatcttaaatctt
tatcggcgcacttattggcttgctaatatggtgcgtgaaggcaagaagtttacaggtcca
gaacaggtaagagaagcagcgactggttgtgcaaggatacggggcgacacgttgggtatt
gtcggccttggtagaattggttctgctgttgcgctgcgtgccaaagcttttggcttcact
gtcatcttttatgatccttatttgccggatggtatcgagaaatcactaggtctcaccagg
gtttacacattacaggatttgctgtttcagtcagattgtgtatctctacactgcacctta
aatgaacacaatcatcatttaataaatgaatatactattaaacagatgagaccgggagca
tttttagtcaatacagcgcgaggtggtttagtggatgacgacgcgctagccgcggcgctc
aaacagggtagaatccgcgcggcagcgctagatgtccacgaaaatgagccatacaacgtc
tttcagggtcagtctgcgaatcagtgtccattgaaagatgcacccaatcttttgtgcacc
ccacacgccgccttctacagcgacgcgagttgcaccgagttacgcgagatggcggctagc
gagatacgacgggcgattgtcggacgcatacccgactgcctacgcaactgcgtgaacaag
gaatatttcctttcttcgaccggaaacggcttttcgagcagatgttaa

DBGET integrated database retrieval system