KEGG   Monomorium pharaonis (pharaoh ant): 105836011
Entry
105836011         CDS       T05760                                 

Definition
(RefSeq) uncharacterized protein LOC105836011 isoform X1
  KO
K05463  ephrin-B
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpha04147]
    105836011
   04052 Cytokines and growth factors [BR:mpha04052]
    105836011
Exosome [BR:mpha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   105836011
Cytokines and growth factors [BR:mpha04052]
 Growth factors
  Growth factors (RTK binding)
   105836011
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 105836011
NCBI-ProteinID: XP_012535207
LinkDB
Position
Unknown
AA seq 424 aa
MWRCNGGERGSRWLWTTATRECCNGCCATSSRSLCFFVFVAAGCGGCRGGGDQWLLSAEY
GRPCLSDGCRSSAAVVTMVSTSFVTLVFLVCLQTVLLSTVSNCAKTISMYWNTTNSIFRI
DNTDHIIDVNKNNAMFEYDQVNIICPVYPPDSYVDDDAEKYIIYNVSKEEYETCRITNPS
PRVIAVCDKPRKTMYFTITFRPFTPQPGGLEFLPGHDYYFISTSSKDDLHRRIGGRCTSH
NMKVVFKVCCGNEAETSSSATSRNNSVVVTSSTVPSSSSTSTAVLGGSAAGLPPQPPPPI
VYRGGDRFYPGGSIHHHHEHHQTGTAAPTLPHVPPPAIYPVHPHQPQSPNHNGPPSSITP
PKTSTGQKKKNKEYSDHPNEVVKNEELTYNGASSYARTQARYAQSLILATCSLLMSALLQ
QLLR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgtggaggtgcaacggtggtgaaagaggtagtaggtggttgtggacgactgcgacgcga
gagtgctgcaacgggtgctgtgcaacctcctcgcggtcgttgtgcttcttcgtgttcgtt
gctgctggttgtggtggttgtcgtggtggtggtgatcagtggttgttgtcggccgagtac
gggcgcccgtgcctaagtgacgggtgccggtcgtccgccgccgttgttaccatggtttcc
acgtccttcgtgaccctggtgttcctagtgtgcctgcaaacggtactactgtcgactgtg
agcaattgcgcgaagacgatcagcatgtactggaacaccaccaattccatatttcgaata
gacaacacagatcatataattgacgtgaacaaaaacaacgcaatgttcgagtacgatcaa
gtcaatataatatgtcccgtgtatcctccggactcgtacgtcgatgacgatgctgagaag
tacatcatctacaacgtgtccaaggaggagtacgagacatgtcggataacgaacccgagt
ccgcgggtaatagcggtgtgcgacaagccgcgcaaaacaatgtatttcaccatcacgttc
aggccgttcacgccgcaacccgggggcctcgagttcctcccgggccacgattactacttc
atcagcacctcatccaaggatgaccttcacaggcgcatcggcggacggtgcaccagccac
aacatgaaggtcgtcttcaaggtctgctgcggcaatgaggccgagacctcctcgtcggcg
acatcgcgcaacaactccgtagtcgtgaccagcagcaccgtgcccagcagcagctcgacg
agcaccgcggttttgggcggctctgccgccggcctgccgccccagccgccgccgccgatc
gtctacaggggcggagatcgattctacccagggggcagcattcatcatcatcacgagcat
catcagacgggcacagcggcgccgaccctgcctcatgtgcccccgccggccatctacccc
gtgcatccgcatcagccgcagtcgccgaatcacaatggaccgccgtcctcgatcacgccg
cccaagacctcgaccggtcagaagaagaagaacaaggagtattcggatcatccgaacgag
gtggtaaagaacgaggagctgacgtacaacggcgcaagctcgtacgcgcgcacgcaagct
cggtacgcgcagagcctgatcctggcgacgtgcagcctgttgatgagcgcgttactgcag
caactgctgcggtga

DBGET integrated database retrieval system