KEGG   Monomorium pharaonis (pharaoh ant): 105839408
Entry
105839408         CDS       T05760                                 

Definition
(RefSeq) fibroblast growth factor 17 isoform X2
  KO
K04358  fibroblast growth factor
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpha04052]
    105839408
   00536 Glycosaminoglycan binding proteins [BR:mpha00536]
    105839408
Cytokines and growth factors [BR:mpha04052]
 Growth factors
  Growth factors (RTK binding)
   105839408
Glycosaminoglycan binding proteins [BR:mpha00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   105839408
SSDB
Motif
Pfam: FGF DUF2464
Other DBs
NCBI-GeneID: 105839408
NCBI-ProteinID: XP_012541150
LinkDB
Position
Unknown
AA seq 248 aa
MRLTLSTLPQLAVLAKILCLLMVVMCGAVPAMVRSVSLYSTCSSGNVTVIGRNVKAVGHN
APYQKLTTQSEDFSRRLYIFAEKSQRYICFNKRWKLVALPKKQKGPMCQFYEVYNGSYLR
YRSAVNDTRYIGFNKFGNPMKNPNGRQECFNFIKYNPHADINYHNSLVNAEMGGIDPREP
YVVSRKPSPVMRATKKNSLLQADSAREHVHTSTHRHRHSNRWKMRQDGADSRLRRRHESR
LLVEASKY
NT seq 747 nt   +upstreamnt  +downstreamnt
atgcgtctcactttaagcacgttaccacagcttgccgttttagcgaagattttgtgcctc
ctgatggtggtgatgtgcggggcggtgccggcgatggtgcgctccgtgagtctctactcg
acttgcagcagcggcaatgttaccgtgataggccgcaacgtcaaagccgtgggacacaat
gcaccctaccaaaagctcaccacacaatcggaagatttcagtaggaggctgtacatcttt
gcggagaagagccaacgatacatttgctttaataagcggtggaaactcgtcgccttgccg
aagaaacagaagggaccgatgtgccagttttacgaggtatacaacggttcctatctgagg
tataggagcgccgtcaacgacacgcggtacatcggcttcaacaagttcggcaatccgatg
aaaaaccccaacggcaggcaggagtgtttcaactttatcaagtacaacccccacgccgac
ataaactaccacaacagcctggtgaacgcggagatgggcgggattgatccgcgggagccg
tacgtcgtctcgaggaaaccgtcgccggtgatgagggccacgaagaaaaactccctgttg
caggccgacagtgcgagggagcacgtccacacgtccacgcatcgccatcggcactcgaat
cgctggaagatgcggcaggacggggcggactcgagactccggagacggcacgagagccgc
ctcctcgtcgaggccagcaagtattga

DBGET integrated database retrieval system