KEGG   Monomorium pharaonis (pharaoh ant): 105840080Help
Entry
105840080         CDS       T05760                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpha01001]
    105840080
Enzymes [BR:mpha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105840080
Protein kinases [BR:mpha01001]
 Receptor tyrosine kinases (RTK)
  RET family
   105840080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Phage_holin_2_4
Motif
Other DBs
NCBI-GeneID: 105840080
NCBI-ProteinID: XP_012542287
LinkDB All DBs
Position
Unknown
AA seq 1223 aa AA seqDB search
MQCQSDLCNWSNDRRVSSIMQRPGLQFVTLLLSSLMVIRISVVSGLYFPQSDLTIKLPYS
AEHKEVKLIDLRTLRNDSTKPQNVKYQIRMPREGSLIYLRNGNDVMLRKFPKNGAVDIII
KGTEENFGEAVLEIKIQPVPVTGKTINCADFVQDMCFWNTSRYKIYENQPVTMIGMFGPE
VYSYVCPKFRVISYELLNGTDYFHIVDGKLFANASLDRDVIGPPPGGPGPHVKIQVRCVI
WEETGIQYAQTEVLTIDVLDEDDNPPKAQGETSINITLEDFSKNSRLIDDNLLVLKDADA
VSSNQYSVRLLNDTANALNVSYSILPIEHHKRPDQVPSTGIFPRIHTKTTLLPKSPYRVV
LQVTDESLLAGYGANSVNISIVFSGPVHQALTTAAPSTVPIFLYPTNTKIARISPRYLRV
AKPSVKPHPSITFILVNGSSAFNVTQRDGIVYVSNETKLRSEPKTVQLKLKWIAAGGTAM
TKTLRVTLIDVPQSKIVTCAQLAQDEMDTCAYAESREKCEKFCGIGSGVLSNGSFIGRCV
WRNNNATQMSEYYSTCSPNLSYCPDNECDELERSVPHMCPQDCTVESDVHFAHMNSDGRG
IKSGLKTCTCDNLLQCMCGIDSFLQGNDVSGMTREERLENRKSRNQKNDIVTLGARKASS
GPCGPTCMIGVIGASLFVLIVIVGSLVMWRYRMAAKGARRECKHRVDDAANGIGILPSDY
IDRGDGLLIGLDTFTAANRHLLLPKTCPPDPKWEFPRSLLKIEQVLGEGEFGRVLRAKAM
NIGGIPGPTTVAVKTLKEDACASELADLLSEYQLLKEAQHPNVIRLLGACTTPPGAPVYL
IIEFAEYGSLRNYLRRSRHLESESRIPAPTSLLSTSPINVGEESQCSDNALNYTITPRDI
LSFAWQISKGMAYLADIKLVHRDLAARNVLLATGKVCKISDFGLTRDVYEDDAYLKRSKG
RVPVKWMAPESLADHVYTSKSDVWSFGVLLWELVTLGASPYPGVDVHNLYNLLKAGYRME
KPANCSQQLYKLMVSCWHQEPSMRPSFKELTSHWERMLEDGVEYLDLNPRTVHNQAYFAS
LQGLDTENGSGNNQVNNETANGTLRTDTVNYLGRISSEPVTKCDKVDKLQALWQPSIASF
PDEPMKSSYVNERPANLTANHYESPIKLRNVSVTSNSENDLRTPPNERPQSYIDMQGKKS
TETEDLLMFGSTDDDRNDNNVTN
NT seq 3672 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgtcaaagtgatctttgcaattggtcgaacgacagacgtgtatcatccatcatg
cagagacctggattgcagttcgtgactttgctgttatcctcgttaatggtgataaggata
tcagtggtctcaggactctacttcccgcaatcagatctcacaataaagttaccgtactcg
gctgaacacaaggaggtgaaattaattgaccttaggactcttcggaacgactctactaag
ccacaaaatgtgaagtaccagatccgcatgccacgcgaagggtctttaatttaccttaga
aatgggaacgacgtcatgttacggaagtttcccaaaaatggcgccgtcgatattattatc
aaagggacggaagagaattttggcgaagcggtacttgaaataaaaatacagccagtaccg
gtgacgggaaaaacaattaactgtgcagattttgtccaggacatgtgcttctggaacaca
tcaagatacaagatttacgagaatcaaccagtcaccatgattggcatgtttggcccggag
gtatacagctacgtgtgtcccaaatttcgcgttatcagttatgaattattgaatggaaca
gactattttcacatagtggacggtaaattatttgcaaacgcatccttagaccgagacgtt
attggacctcctccgggaggacctggacctcacgttaaaattcaggtgagatgcgttatt
tgggaagagaccgggatacagtacgcacaaacggaagtccttactatcgacgttctggat
gaagacgacaatcctccgaaagcgcaaggcgaaacttccatcaatataacgcttgaggat
ttctccaagaactctaggttgatagacgataatcttttagtcctgaaggacgcggatgcc
gtgagcagcaaccagtacagcgttcgtttgcttaatgatactgcaaatgcattaaacgta
agttacagcattctaccgattgagcatcacaaacgcccggatcaggtgccttcgactggt
atttttcccaggatccacacgaagacgacactattgccgaaatcaccataccgcgtggtc
ctgcaggtcacggatgagtcgcttctagcgggatacggggcgaattcggtgaacatcagt
atagttttctcagggccggtacatcaagctttaacaaccgcagcgccatcgactgtcccg
atatttttgtatccgacgaatacgaagatagcccggatttcgcctagatatttacgcgtg
gcaaaacccagcgtgaagccgcatccttcgataactttcattctcgtgaacggctcgagt
gccttcaacgtcacccaacgggatggtatcgtttacgtttccaatgaaactaagctacga
tccgagcccaaaaccgttcaactgaagttaaaatggatcgcagcaggtggtaccgcgatg
accaagacgctgcgagtgactctgattgatgtgccgcaatcgaagatcgtcacgtgcgca
caattggctcaagacgagatggacacatgcgcgtacgcggaatctcgcgagaaatgcgaa
aagttctgcggaattggcagcggagtcctcagcaatggcagtttcatcggtcgatgcgtt
tggagaaacaacaacgctactcaaatgtcagaatattattccacttgttctccgaatctg
tcgtactgtccggacaacgaatgcgacgaactggagcgcagcgttccgcacatgtgtccg
caagactgcaccgtcgaatctgatgttcatttcgcccacatgaatagcgacggccgcggc
attaagagcggcctgaaaacttgcacctgcgacaatctactacagtgcatgtgcggaatc
gactcctttttgcaaggaaatgatgtgtccggaatgacaagggaggaacgcttggaaaac
agaaaatcacgtaatcaaaaaaacgacattgtcacgttgggcgcgcgcaaagcatccagt
ggaccgtgcggtcctacgtgcatgataggtgttattggggctagtctgtttgtgttgatc
gtgattgtggggtcattagttatgtggagatataggatggcggcgaagggcgctcgacgg
gaatgcaaacacagggtggacgatgcggcaaatggtattggtattttgccgtcggactac
atcgatcgcggcgatggtctcctgatcggtttggacactttcacagcggcgaatcgtcat
ttattgttaccgaagacatgcccgccggacccaaagtgggaatttccacgatcgctcctg
aagatcgagcaagtgctgggcgagggcgagttcgggcgcgttttgcgcgccaaggccatg
aacatcggcggaattcccggacctacgaccgtcgcggtgaagaccctgaaggaggacgcg
tgcgcctccgaactggcagatctactatccgaataccagctgctaaaggaggcacagcat
ccgaacgtgatccgactgctgggtgcttgcacgacaccgccgggcgcgcccgtctacctc
atcatcgaattcgccgaatacggctccttacgtaactatctgagacgcagccggcacttg
gagtcggagagtaggatcccggcaccgacgtcactgctttccacttcgccgatcaacgtc
ggcgaggaatcgcaatgtagcgataatgcattgaactatactataacgccgcgcgatatt
ctctcgttcgcctggcaaataagtaaaggaatggcatatctcgccgatattaagttggtg
catcgggatctcgcggcgaggaatgttttgcttgcaaccggtaaggtttgcaagatctcg
gacttcggtctaactcgtgatgtatatgaggacgatgcgtacttgaagcggagcaaggga
cgagtgcctgtaaaatggatggcgccagaatccctggccgaccatgtgtacaccagcaaa
tcggacgtttggagcttcggcgtgctcctgtgggagttggtcacgttaggagcctccccg
tatcctggagtggacgtgcataatctctacaatctactgaaggccggctaccgtatggag
aagccggctaattgctcgcaacagttatacaagttaatggtgtcgtgttggcatcaagag
cccagcatgcgaccgtctttcaaggaactaactagtcattgggagcgcatgctagaggat
ggtgttgaatacctcgatcttaatccacgaactgttcacaatcaagcctactttgcatct
ctacaaggcttggacaccgaaaatggttctggtaacaatcaagtgaataacgagactgct
aatgggactctaaggacagataccgtcaactacctcggccgaatatcttctgagcctgtc
acaaaatgcgacaaggtggacaagctgcaggcgctctggcaaccgtctatagcgtccttc
cctgacgagcccatgaagtcatcttacgtgaacgaacgacccgcaaacttgaccgccaat
cattacgaaagtccgataaagctgagaaatgtcagcgtgaccagtaacagtgaaaacgac
ctaagaacacctcctaacgaacgtcctcagtcctatatcgatatgcaagggaagaaatcg
acggagacagaggacctcttgatgtttgggagcacggatgacgacaggaatgacaataac
gtgacgaattga

DBGET integrated database retrieval system