KEGG   Monomorium pharaonis (pharaoh ant): 105840098
Entry
105840098         CDS       T05760                                 

Definition
(RefSeq) uncharacterized protein LOC105840098
  KO
K16859  placenta growth factor
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpha04052]
    105840098
Cytokines and growth factors [BR:mpha04052]
 Growth factors
  Growth factors (RTK binding)
   105840098
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 105840098
NCBI-ProteinID: XP_012542316
LinkDB
Position
Unknown
AA seq 137 aa
MRKLLLLIICIQIALNVVGRHHRDSDFLSHVQLVHQFQCSLPQSRAIAVEDLLTVGLGPD
EAFYPASTVLTRCTGSGCCLNSEQICAPIETRNVTLVFMVRHRIDQQRDRHHEVIHAIEH
TKCACVDKILATKDFRF
NT seq 414 nt   +upstreamnt  +downstreamnt
atgaggaaacttttgttattgataatctgcattcagattgcattaaatgtcgttggcagg
caccatagggacagtgattttttgagccacgtgcagctggtgcatcagtttcaatgttca
ttgccccaatcgcgggcgatcgcagttgaggatctcctgaccgtaggcctcggacctgac
gaagctttttatcctgcatccacggtcctgacacgttgcaccggatcaggatgctgcctc
aactccgaacagatatgcgcgccgatagaaactagaaacgtcaccctcgtcttcatggtc
aggcatcgcattgatcaacaacgagatcgtcaccatgaagtcattcatgctatcgaacat
accaagtgcgcctgcgtggataaaattctggctacgaaggattttaggttttga

DBGET integrated database retrieval system