KEGG   Monomorium pharaonis (pharaoh ant): 105840254
Entry
105840254         CDS       T05760                                 

Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha04068  FoxO signaling pathway
mpha04150  mTOR signaling pathway
mpha04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105840254
   04150 mTOR signaling pathway
    105840254
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    105840254
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpha04052]
    105840254
Cytokines and growth factors [BR:mpha04052]
 Growth factors
  Growth factors (RTK binding)
   105840254
SSDB
Motif
Pfam: Insulin BmKX
Other DBs
NCBI-GeneID: 105840254
NCBI-ProteinID: XP_012542591
LinkDB
Position
Unknown
AA seq 230 aa
MMMIRGRRTMTGTALLIALISLSALHAADAQDTYRKSHIKMQKLCSRKLSDALYLVCRER
GYNEPFSYSNEDEPRGDPGPGLVDECCYHQCTLGMLEAYCKPLPEEKRVGSRDDVIDQSY
LANLPHSTTKDLLEQHPQAGMDYAGDAIKRKVDDLKRGRQRGKSDRNVDGECKGKADAKK
RHRGRHCRCRRRRPECRRAGKVSRNNVKPLDNKFVTSSTTDEPTSFPSVS
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatgatgatacgaggtcgccgtacgatgaccgggacggcgcttctgatcgcgctgatc
tccctgtccgcgctccacgctgccgacgctcaagacacctacaggaagtcgcatattaag
atgcaaaaactgtgctccaggaaactgagcgacgccctgtacctcgtgtgccgggaacgc
ggctacaacgaaccgttctcgtatagtaacgaggatgagccgagaggagatcccggcccg
ggactcgtcgacgagtgctgttatcatcagtgtaccctcggaatgctcgaggcatactgc
aagcccctacccgaggagaagcgggtcggctcgagggacgacgtcatagaccagtcgtat
ctagcgaatctacctcattccacgacaaaagatctgctggagcagcatccgcaggcgggg
atggactacgccggtgatgcgataaaacgtaaggtcgatgatttgaaaaggggacggcag
agggggaaaagtgatcgcaatgttgatggtgaatgcaaggggaaggctgatgcaaaaaag
cgacaccgcggcaggcattgcagatgccggcgtcggcgtccggagtgtcgccgagctggc
aaggtttcgcgcaacaacgttaaacctctagacaacaaatttgtaacgtcgtcgacgact
gacgaacctacatcgtttccctccgtatcgtaa

DBGET integrated database retrieval system