KEGG   Monomorium pharaonis (pharaoh ant): 105841151Help
Entry
105841151         CDS       T05760                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform isoform X1
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
mpha  Monomorium pharaonis (pharaoh ant)
Pathway
mpha00071  Fatty acid degradation
mpha01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105841151
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mpha03029]
    105841151
Enzymes [BR:mpha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     105841151
Mitochondrial biogenesis [BR:mpha03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    105841151
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N RHH_7
Motif
Other DBs
NCBI-GeneID: 105841151
NCBI-ProteinID: XP_012543743
LinkDB All DBs
Position
Unknown
AA seq 795 aa AA seqDB search
MAEAHSAVAFSFSITHEGWDVNFDREVLHLVWQSGVRSWKKRFFRFQNNLKSGVYPASLE
SLWITVILVTAIHFAGYKVPYDLVGKVSPYLFASSILAHLAGSFVVGLFLWLAVIYMIRY
TLKLLLMYKGWMYESRGKGRRPSKLTQVWVLLVKLFSGWHKPMLYSFQGSLPRLPLPTVP
DTMKRYLRSVRPLLDDENYARMEKLANEFQNGIGVKLQRYLILKSWWTTNYVSDWWEEYV
YLRGRSPLMVNSNFYGIDAILSHPTNVQAARAAAVIYSCLQYRRLIERQELEPILVQGIV
PLCSWQYERVFNTTRIPGIECDKIVHYQDSKHIVVYHKGRYFKVLIYYRNRILQACEIEL
QIQQILDDNSTPSEGEEKLAALTAGERTAWAQARKDFFTKGVNKASLDIIEKAAFVVALD
DVPYEYDPKHPEKLDHYGRVLLHGKGYDRWFDKSFTLCIGSNGRIGFNAEHSWADAAVMS
HLWEYIVCSEFLDQQADAPVLGTLWEFIIAADIEIGYKDGHNAGNPEFAPPTPIRLQWDL
NAKCVEAIEQSYKVALSILNEIELRVYVHDAYGKGLMKNHSISPDAYIQMALQLAYYRDA
GKFNLTYEASMTRLFREGRTETVRPCTIESSKWVKAMEDKTITVTEKIKLLMDAVGRHQR
GYQDAMCGKGIDRHLFCLYVVSKYLEVDSPFLKKVLSEPWRLSTSQTPHGQTSKLDLKKY
PNCISAGGGFGPVADDGYGVSYIIAGEDLLFFHVSSKRSSSKTDAARFAKQIEKALGDMK
DLLEQKKKIHQNGSA
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcccattcagccgtagcattcagcttttcgataacacacgaaggatgggac
gtaaacttcgatcgagaagtactccacttggtctggcagtctggtgtacgatcatggaaa
aaaagattctttcgatttcagaacaatctgaaaagcggcgtttatccagcttctttggag
agtctatggatcactgtaattttagtaacggcgatacactttgctggttataaagttccg
tatgacctcgttggaaaagtttcaccatatctttttgcatcctcaatactagcacacctg
gcaggctccttcgtagtcgggctgtttctatggttggcagtcatatacatgattcgatat
acgctgaaattgttacttatgtacaaaggatggatgtacgagtcaagaggcaaaggtcgc
aggccatcgaagttgactcaggtctgggtgttgctggtgaaattgttttcaggttggcat
aagcccatgttatacagtttccaaggatcactgccacgattgccgctaccgacagtacct
gatactatgaagcggtatctgaggagtgtacggccgttgctcgatgatgagaattacgct
cgcatggaaaagttggccaacgagtttcagaacggcatcggagtcaagttgcaacgttac
ctgattcttaagtcttggtggaccaccaactacgtatctgattggtgggaggagtatgtt
tatttacgcggtagatcgcctttaatggttaactcgaatttttatggaatcgatgccatt
ctctcgcatcctacaaacgtacaagccgcgcgagccgcagccgtaatatattcctgctta
caatatagacgtctcatcgaacgccaagagttagaaccgattctagtacaaggaatagta
ccattgtgttcttggcagtatgaaagagtattcaatactacacgaattccaggaattgaa
tgtgataaaattgtgcattaccaggattctaaacatattgtagtgtatcataagggcaga
tatttcaaggttttaatttattaccgaaatagaattcttcaagcctgtgagatagaactt
caaattcaacaaattttggatgataattcaacaccatcagaaggagaggagaaattggct
gctttgacagctggtgaaagaactgcctgggcacaagccaggaaagacttcttcacgaaa
ggtgtaaataaggcttctttggacattattgagaaggccgcatttgtggtcgcattggac
gatgtaccttatgaatacgatccaaaacatccagaaaaattggatcattatggtagagtc
ctattacacggaaaaggatatgatcgatggttcgataaatcttttacgctatgcattgga
agcaacggcagaattggcttcaacgcagaacattcttgggcagatgctgcagtcatgtca
cacttgtgggagtacatagtatgttcggagttcctggatcaacaggccgatgcgccagtg
ctcggaactctatgggaatttattatagctgctgatattgaaatcggatataaggacgga
cataatgcgggtaatccagaatttgcacctccaactccaattcgattgcaatgggattta
aatgccaaatgtgttgaagctattgaacaatcttataaggtagcgctcagtatattaaat
gagattgaattacgtgtttatgtgcatgatgcttatggaaaaggtttgatgaaaaatcac
tccatatcaccagacgcttatatacaaatggcattacaattagcgtattatcgtgatgct
ggtaaatttaatttaacttatgaagcttccatgacgaggttgtttcgagaaggtagaaca
gaaacagttagaccatgcactattgaatcttctaaatgggttaaagctatggaagataaa
acaataacggtaacagaaaaaatcaagttgttaatggatgcagtgggaagacatcaaaga
ggttatcaagatgccatgtgtggtaaaggaatagacaggcatctgttctgtttatatgta
gtatcaaagtacttagaagtagattcaccatttttgaagaaagttctaagcgagccatgg
agattgtcaacatcgcaaacgccacatggccaaacatcaaaattggatttgaagaagtat
cccaactgtatttcagctggtggtggatttggtcctgtagccgatgatggctatggtgtt
tcttacataattgcaggagaagatcttctatttttccatgtttctagtaaacgatcttca
tcaaaaacggatgccgccagatttgcaaaacaaatcgagaaagcacttggcgatatgaaa
gacttgctagaacaaaaaaagaaaatacatcagaatggatctgcgtaa

DBGET integrated database retrieval system