KEGG   Mycolicibacterium phlei: MPHLCCUG_00304Help
Entry
MPHLCCUG_00304    CDS       T04305                                 

Definition
(GenBank) Putative DNA ligase-like protein
Organism
mphl  Mycolicibacterium phlei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AMO59146
LinkDB All DBs
Position
299761..300840
Genome map
AA seq 359 aa AA seqDB search
MPTVCTGMTAIMGGMDLPVLPPLEPMLAKAQTRVPPEAGVWSYEPKWDGFRALVFRDHDE
VVLLSRSGKDLGRYFPEVTEAVRDELAPRCVLDGEIVVPREIDGRTRLDWESLSQRIHPA
ASRIKLLSEETPAHFIGFDALALGDRSLLKEPFRTRRDALKDAVSEKQWCHVTRTTENPD
LGAQWLEEFEGAGLDGVIAKRLDGPYLPGKREMVKVKHARDADCVAMGYRIHKSGEGIGS
ILLGLYRGDELYMVGGATSFTAKDRVKLLTELEPLRIGDEMRDGDPSRWNSAADKRWVPI
RPEKVCEVAYDQMEGNRGAQRFRHAVKFRRWRPDRDPRSCTFDQLDVPLHYDLNDVLES
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccgacggtctgcaccggcatgacggcaataatgggcgggatggacctcccggtgctc
ccgccgctcgaaccgatgctggccaaggcgcagaccagggtgccgcccgaggccggggtg
tggtcctacgagcccaaatgggacggctttcgtgccctggtgttccgcgaccacgacgag
gtcgtgctgctgtcgcgcagcggcaaagacctcggtcgctacttcccggaggtcaccgag
gccgtccgcgacgaactcgcaccccgctgcgtgctcgacggcgagatcgtcgtcccccgc
gagatcgacggccgcacccggctggactgggagtcgctgagccagcgcatccaccccgcc
gccagtcgcatcaagctgctgtccgaggagacccccgcccacttcatcggcttcgacgcc
ctggccctcggcgaccgctcgctgctcaaggaaccgttccggacacgacgcgacgcgctc
aaagacgccgtcagcgagaaacagtggtgccacgtcacccgcaccaccgaaaacccggac
ctcggcgcgcagtggctcgaggagttcgagggcgccggcctcgacggcgtcatcgccaaa
cgcctcgacggcccctacctccccggtaaacgggagatggtcaaggtcaagcacgcccgc
gatgccgactgcgtggccatgggctaccgcatccacaagagtggcgagggcatcggctcg
attctgctcggcctctaccgcggcgacgaactctacatggtcggcggcgcaacctctttc
accgccaaggaccgcgtcaaactcctcaccgaactcgagcccctgcgcatcggcgacgag
atgcgcgacggcgaccccagccgctggaactccgccgccgacaaacggtgggtacccatc
cgcccggagaaggtctgcgaggtcgcctacgaccagatggaaggcaaccgcggcgctcaa
cgcttccgccacgccgtgaagttccgccgctggcgccccgaccgcgacccccgcagctgc
accttcgaccagctcgacgtcccgctgcactacgacctcaacgacgtcctggagtcctga

DBGET integrated database retrieval system