KEGG   Mycolicibacterium phlei: MPHLCCUG_00560Help
Entry
MPHLCCUG_00560    CDS       T04305                                 

Gene name
sodA
Definition
(GenBank) Superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mphl  Mycolicibacterium phlei
Brite
Enzymes [BR:mphl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MPHLCCUG_00560 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMO59398
LinkDB All DBs
Position
557343..557963
Genome map
AA seq 206 aa AA seqDB search
MAEYTLPELDYDYAALEPHISGQINEIHHSKHHATYVKGVNDAIAKLEEARANGDHGAIF
LHEKNLAFHLGGHVNHTIWWKNLSPHGGDKPTGDLAAAIDDQFGSFDNFRAQFTAAANGL
QGSGWAVLGYDTLGDRLLTFQLYDQQANVPLGIIPLLLVDMWEHAYYLQYKNVKADYVKA
IWNVVNWQDVQVRFAAATGKGPEPIV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtacaccctgcccgagctcgattacgactatgcggccctggaaccgcatatc
tccggacagatcaacgagattcaccacagcaagcaccacgccacctacgtcaagggcgtc
aacgacgcgatcgccaagcttgaagaagcgcgcgccaacggcgatcacggcgcgatcttc
ctgcacgagaagaaccttgcgttccacctcggcgggcacgtcaaccacacgatctggtgg
aagaacctgtccccgcacggtggcgacaagccgaccggggatctcgcggctgcgatcgac
gaccagttcggatcgttcgacaactttcgcgcgcagttcaccgcggccgccaacggtttg
caggggtccggctgggcggtgttgggctacgacaccctcggtgaccggctgctgaccttc
cagttgtacgaccagcaagcaaatgtcccactggggatcatcccgctgttgctggtcgac
atgtgggaacatgcgtactacctgcagtacaagaacgtcaaggccgactatgtgaaggcg
atctggaacgtcgtcaactggcaagacgtgcaggtgcgcttcgccgctgccaccggcaag
gggccggaaccgatcgtctga

DBGET integrated database retrieval system