KEGG   Mycolicibacterium phlei: MPHLCCUG_00885Help
Entry
MPHLCCUG_00885    CDS       T04305                                 

Gene name
gutB_1
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00040  Pentose and glucuronate interconversions
mphl00051  Fructose and mannose metabolism
mphl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MPHLCCUG_00885 (gutB_1)
   00051 Fructose and mannose metabolism
    MPHLCCUG_00885 (gutB_1)
Enzymes [BR:mphl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     MPHLCCUG_00885 (gutB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AMO59716
LinkDB All DBs
Position
complement(861276..862277)
Genome map
AA seq 333 aa AA seqDB search
MRAAVLLEPGRIELQERPVPRPDPGDVLIRVSAVGVCGSDTHYYRHGRIGEFVVEAPLVL
GHEAAGTIVDVGEGVDRSRIGQRVSIEPQRPDPDSAETRRGHYNLCPHMRFYGTPPVDGA
LCDYVTIGAQFAHPVPDSMSDDAAALCEPLSVGIAATRKAGIGEGSRVLIAGAGPIGIVL
AQVARAYGATDIVVTDPVEARRTQARSFGATEVLDPTAGPLPDLGVDAFIDASGAPSAIT
DGIRAVRPAGNVVLVGLGAETMELPVQVIQNRELVLTGVFRYADTWPTAIELVESGRVDL
DAMVTARFPLERTAEALDSDRTPGSVKSVVTVS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgggccgccgtcctcctcgaacccggacgcatcgaactgcaggaacggccggtcccc
cgccccgaccccggcgacgtgctgatccgggtgtccgcggtgggggtgtgcggatcggac
acccactactaccggcacggccggatcggcgagttcgtcgtcgaggcccccctggtgctc
ggccacgaggccgcgggcaccatcgtcgacgtcggcgagggggtggaccgctcgcggatc
ggtcagcgggtgtcgatcgagccgcagcgccccgacccggactccgccgagacccgccgc
ggccactacaacctgtgcccgcacatgcggttctacgggacaccgccggtcgacggcgcg
ctgtgcgactacgtcacgatcggcgcgcagttcgcgcacccggtgccggactcgatgtcc
gacgacgccgcggcgctgtgcgaaccgctgtcggtgggcatcgcggcgacgcgcaaggcg
gggatcggcgagggctcccgggtgctgatcgccggtgcggggccgatcggcatcgtgctg
gcccaggtggcgcgcgcgtacggggcgaccgacatcgtcgtcaccgatccggtcgaggcc
cgccgcacccaggcccgctcgttcggcgcgaccgaggtgctcgatccgaccgcgggcccg
ctgccggacctgggggtcgacgcgttcatcgacgcctccggggcgccgtcggcgatcacc
gacgggatccgcgcggtgcggccggcgggcaacgtcgtgctggtcgggctgggcgcggag
acaatggaactgccggtgcaggtgatccagaaccgggaactggtgctgaccggggtgttc
cggtacgccgacacatggccgacggcgatcgaactggtcgagtccggccgggtcgacctc
gacgcgatggtgaccgcgcggttcccgctggagcgcaccgccgaggcgctggactccgat
cgcacaccgggtagcgtcaagagcgtggtgacggtgtcatga

DBGET integrated database retrieval system