KEGG   Mycolicibacterium phlei: MPHLCCUG_00892Help
Entry
MPHLCCUG_00892    CDS       T04305                                 

Definition
(GenBank) Putative DNA ligase-like protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MPHLCCUG_00892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mphl03400]
    MPHLCCUG_00892
Enzymes [BR:mphl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MPHLCCUG_00892
DNA repair and recombination proteins [BR:mphl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MPHLCCUG_00892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AMO59723
LinkDB All DBs
Position
867973..870240
Genome map
AA seq 755 aa AA seqDB search
MKLTNPDKVLYPATGTTKGQVFDYYVGIAEAMIPHIAGRAVTRKRWPNGVEEASFFEKQL
ASSAPEWLDRASVTHRSGTTTYPLIDTAEGLAWIAQQAALEVHVPQWRFVGEGGERKPGP
ATRIVFDLDPGEGVTFRQLCEVAHEVRDLISDIGLTTYPLTSGSKGLHLYVPLEEPISSR
GASVLARRVAQQLEQTMPKQVTATMTRSLRTGKVFVDWSQNSAAKTTIAPYSLRGREHPT
VAAPRTWDEIADPKLRHLRFDEVLERVQEMGDLLAPLDETVPVPDRLTAYRSMRDAAKTP
EPVPVKPPKPGQDNRFVIQEHHARRLHYDLRLERDGVLVSWAVPKNLPDTPSVNHLAVHT
EDHPLEYLTFHGEIPKGEYGGGRMIIWDTGTYEAEKFNDVPPDSKRQGGEVIITLHGSTI
DGRYALIQTDGKNWLAHRMKEQQRPHAGDIAPMLSTEGSVARLTSKQWAFEGKWDGYRMI
LDADHGTLRLRSRSGRDVTAEFPQFQAIAADLADHHVILDGEAVALDESGVPSFGEMQNR
ARSTRVEFWAFDILHLDDRPLLRAKYSDRRRILGALADGGGLIVPDRLPGDTGADALEYA
RTKRWEGVVAKKLDSTYQPGRRSKSWIKDKLWNTQEVVIGGWRRGEGGRSTGIGALMLGV
PVDGGLQFVGRVGTGFTDKELDKLKTTLEPLHTDESPFLDPLPRQDARGVTFVRPELVGE
VRYSERTSDNRLRQPSWRGLRPDKSPDEVRWEGMG
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctgaccaacccggacaaggtgctgtacccggcgacgggcaccaccaagggccag
gtgttcgactactacgtcggcatcgccgaggcgatgatcccgcacatcgcgggccgcgcc
gtcacgcgcaagcgctggcccaacggtgtcgaggaggcgtcgttcttcgagaagcagctc
gcgtcgtcggcgccggagtggctggaccgcgcatcggtcacccaccggtccgggaccacg
acctacccgctgatcgacaccgccgagggactggcctggatcgcgcagcaggcggcgctg
gaagtgcatgtgccgcagtggcggttcgtcggcgagggcggggagcgcaaacccgggccg
gccacccgcatcgtgttcgacctcgaccccggcgagggcgtgaccttccggcagctgtgc
gaggtggcccacgaggtgcgcgacctgatcagcgacatcgggctgaccacctacccgctg
accagcggcagcaagggcctgcacctgtatgtcccgctggaggagccgatcagctcgcgg
ggtgcgtcggtgctggcgcgccgtgtcgcccagcagctcgaacagacgatgcccaaacag
gtcaccgcgacgatgaccaggagcctgcgcaccggcaaggtgttcgtcgactggagccag
aacagcgccgccaagaccaccatcgcgccgtattcgcttcgcggacgcgaacatccgacc
gtcgccgcgccccgcacgtgggacgagatcgccgatccgaagctgcgccacctgcgcttc
gacgaggtgctcgagcgggtgcaggagatgggcgacctgctggcgccgctggacgagacg
gtcccggtgcccgaccggttgaccgcctaccgcagcatgcgcgacgcggcgaaaacccct
gagcccgttccggtcaaacccccgaaaccggggcaggacaaccggttcgtcatccaggag
caccacgcccgccggctgcactacgacctgcgtctggaacgcgacggggtgctggtcagc
tgggcggtgccgaagaacctgcccgacaccccgtcggtgaaccacctcgccgtgcatacc
gaggaccatccgctggaatacctgaccttccacggcgagatccccaagggcgagtacggc
ggcggcaggatgatcatctgggacaccggcacctacgaggccgagaagttcaacgacgtc
ccgcccgacagcaagcgccagggcggcgaggtgatcatcaccctgcacggctcgacgatc
gacggccgctacgcgctgatccagaccgacggcaagaactggctggcgcaccggatgaag
gaacagcagcgcccgcacgccggcgacatcgcgccgatgctgtccaccgagggatcggtg
gcgcggctcaccagcaagcagtgggcgttcgagggcaagtgggacggctaccggatgatc
ctcgacgccgaccacggcacgctgcggctgcgctcgcgcagcggccgcgacgtcaccgcc
gagttcccccaattccaggccatcgcagccgatctcgccgaccatcacgtcatcctcgac
ggcgaggcggtcgcgctcgacgagtccggggtgccgagcttcggcgagatgcagaaccgc
gcccgctccacccgggtcgagttctgggcgttcgacatcctgcacctcgacgaccggccg
ctgttgcgcgccaagtactccgaccggcgcaggatcctcggggcgctggccgacggcggc
gggctgatcgtgccggaccgactgcccggcgacaccggtgccgacgcactcgagtacgcg
cgcacgaagcgctgggagggtgtggtcgccaagaagctcgactcgacgtatcagccgggg
cgacggtcgaagtcgtggatcaaggacaagctgtggaacacccaggaggtggtgatcggc
ggctggcgccgcggcgagggcggccgctccaccgggatcggtgcgctgatgctgggggtc
ccggtcgacggtggactgcagttcgtcggccgggtgggtaccgggttcaccgacaaggag
ctcgacaagctcaagacgacgctcgaaccgctgcacaccgacgagagcccgttcctcgac
ccgctgccgcgccaggacgccaggggcgtgacgttcgtgcggcccgagctcgtcggcgag
gtccgctacagcgaacgcacctccgacaaccggctgcgccaacccagttggcgggggctg
cggccggacaaatcacccgacgaggtccgctgggaaggcatggggtaa

DBGET integrated database retrieval system