KEGG   Mycolicibacterium phlei: MPHLCCUG_01428Help
Entry
MPHLCCUG_01428    CDS       T04305                                 

Gene name
gadB
Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00250  Alanine, aspartate and glutamate metabolism
mphl00410  beta-Alanine metabolism
mphl00430  Taurine and hypotaurine metabolism
mphl00650  Butanoate metabolism
mphl01100  Metabolic pathways
mphl01110  Biosynthesis of secondary metabolites
mphl01120  Microbial metabolism in diverse environments
mphl02024  Quorum sensing
Module
mphl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MPHLCCUG_01428 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPHLCCUG_01428 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MPHLCCUG_01428 (gadB)
   00430 Taurine and hypotaurine metabolism
    MPHLCCUG_01428 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MPHLCCUG_01428 (gadB)
Enzymes [BR:mphl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MPHLCCUG_01428 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AMO60253
LinkDB All DBs
Position
1466344..1467726
Genome map
AA seq 460 aa AA seqDB search
MPRKRSHAPQVAPAYTGRLAMAPVPSLRLPDDAMDPDAAYRFIHDELMLDGSSRLNLATF
VTTWMDPQAERLMAETFDKNMIDKDEYPATAAIEQRCVCMVADLFHAEDLRDDDPSSAIG
VSTIGSSEAVMLAGLAMKWRWRDRVGDGWKGRTPNLVLGANVQVVWEKFCRYFDVEPRYL
PMAEDRFVITPEQVVEAVDEDTIGVVGILGTTYTGELEPIAEICAALDKLAADGGPDVPV
HVDAASGGFVVPFLHPDLEWDFRLPRVVSINVSGHKYGLTYPGIGFVVWRSKEYLPEGLV
FHVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYSQVMHSLSQTARWLGDQLEAS
EHFDVVSDGSAIPVVAFKLKRDFGYTEFDVSQALRSFGWQVPAYTMPEGAEDVRMLRIVV
REGFSADLARALYEDLAKVISHLDALQPKGLFNTEQPFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcaagcgcagtcacgcgccccaggtcgcgcccgcctacaccggacggttggcg
atggcgcccgtgccgtcgctgcgcctgcccgacgacgcgatggaccccgacgccgcctac
cgcttcatccacgacgagctgatgctcgacggcagcagccggctcaacctcgcgacgttc
gtcaccacctggatggacccgcaggccgaacgtctgatggcagagacgttcgacaagaac
atgatcgacaaggacgagtacccggccaccgcggcgatcgagcagcgttgcgtgtgcatg
gtcgccgatcttttccacgccgaggacctgcgcgacgacgacccgtccagcgccatcggg
gtgtccaccatcggctccagtgaggccgtcatgctggccgggctggcgatgaagtggcgg
tggcgcgaccgcgtcggcgacggttggaagggccgcacccccaacctggtgctgggcgcc
aacgtgcaggtggtgtgggagaagttctgccgctacttcgacgtcgagccgcgctacctg
ccgatggccgaggaccgcttcgtcatcacccccgagcaggtggtcgaggccgtcgacgag
gacaccatcggcgtggtcggcatcctcggcaccacctacaccggcgagctcgagccgatc
gccgagatctgcgcggcgctggacaaactcgccgccgacggcggcccggacgtcccggtg
cacgtcgacgcggccagcggcggcttcgtggtgccgttcctgcacccggacctggagtgg
gacttccggctgccccgggtggtgtcgatcaacgtctccggccacaagtacggcctgacc
tacccgggcatcgggttcgtggtgtggcgcagcaaggagtacctgcccgaggggttggtc
ttccacgtcaactacctcggcggcgacatgccgacgttcacactgaacttctcccgcccg
ggcaaccaggtcgtcggccagtactacaacttcctgcgcctcggccgcgccggctactcg
caggtgatgcacagcctgtcgcagaccgcgcgctggctcggcgaccagctcgaggccagc
gaacacttcgacgtcgtctccgacgggtcggcgatcccggtggtggcgttcaagctcaag
cgtgatttcggctacaccgagttcgacgtgtcgcaggcgctgcggtcgttcggctggcag
gtgcccgcctacacgatgcccgagggcgccgaggacgtccggatgctgcgcatcgtggtc
cgcgagggtttctccgccgacctggcccgtgcgctctacgaggatctggccaaggtgatc
agccacctcgacgcgctgcagccgaagggtctgttcaacaccgagcagccgttcgcccat
tag

DBGET integrated database retrieval system