KEGG   Mycolicibacterium phlei: MPHLCCUG_02007Help
Entry
MPHLCCUG_02007    CDS       T04305                                 

Definition
(GenBank) Glycogen synthase
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00500  Starch and sucrose metabolism
mphl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPHLCCUG_02007
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mphl01003]
    MPHLCCUG_02007
Enzymes [BR:mphl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MPHLCCUG_02007
Glycosyltransferases [BR:mphl01003]
 Polysaccharide
  Storage polysaccharide
   MPHLCCUG_02007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glycogen_syn Glyco_trans_4_2 KR
Motif
Other DBs
NCBI-ProteinID: AMO60827
LinkDB All DBs
Position
complement(2071713..2072954)
Genome map
AA seq 413 aa AA seqDB search
MKVLMVSWEYPPVVVGGLGRHVHHLATALAEAGHEIVVLSRRPTGTDPSTHPTSVEVVEG
VKVVAAAQDPHEFEFGTDMMAWTLAMGHSMIRAGLAIKTAEGEPWQPDVVHAHDWLVAHP
SIALAEFFDVPLVSTIHATEAGRHSGWVSGRISRQVHAVESWLVHESDSLITCSTSMSEE
ITELFGPGLVEIRVIRNGIDCARWPFAQRQPRSGPAQLLYLGRLEYEKGIQDAIAALPRI
RRTHPGTTLTIAGEGTQLEWLKEQARKHKVFKATKFVGHLDHEQLVQLLHTADVAVLPSH
YEPFGIVALEAAATGIPLVTSNVGGLGEAVIDGETGVSYPPRDVAALAAAVRSVLDDPDA
AQRRAVAARERLGSDFEWHSIADETAQVYLASKRREREPHRRRPIVEHALPGR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctgatggtttcgtgggagtacccgccggtggtggtgggcggtctgggccgc
cacgtgcatcacctggcgaccgcgctcgccgaggccggccacgagatcgtggtgctcagc
cgtcggcccaccggaaccgacccgtccacccacccgacgagcgttgaggtggtcgagggc
gtcaaagtggttgccgcggcgcaggatccgcacgagttcgagttcggcaccgacatgatg
gcctggacgctggcgatggggcactcgatgatccgggccgggctggcgatcaagaccgcc
gagggcgaaccgtggcagcccgacgtggtgcacgcgcacgactggctggtcgcgcacccg
tcgatcgcgctggccgaattcttcgatgtgccactggtttccacgatccacgccaccgag
gccggccggcactccgggtgggtgtcgggccggatcagccgccaggtgcacgccgtggag
tcgtggctggtgcacgaatccgactcgctgatcacatgttcgacgtcgatgagcgaggag
atcaccgagctgttcggcccgggcctggtcgagatccgggtgatccgcaacgggatcgac
tgtgcgcgctggccgttcgcgcagcgtcagccgagaagcggtccggcgcagctgctctac
ctgggccggctggagtacgagaagggcatccaggacgccatcgccgcgctgccgcggatc
cgtcgcacccatccgggtaccacgctgacgatcgcgggcgagggcacccagctggagtgg
ctcaaggagcaggcgcgcaagcacaaggtcttcaaggcgacgaagttcgtcgggcacctc
gaccacgagcagttggtgcagctgctgcacaccgccgacgtggcggtgctgccgagccac
tacgagccgttcgggatcgtcgcgctggaggccgccgcgaccgggatcccgctggtgacg
tcgaacgtcggcgggctcggcgaagcggtgatcgacggtgagacaggggtgtcgtacccg
ccgcgagacgtggcggcgctggcggcggcggtgcgctcagtgctcgacgatcccgatgcc
gcgcagcggcgggcggtcgccgcgcgggagcggctggggtcggatttcgagtggcactcc
atcgccgacgagaccgcgcaggtttatctggcgtccaaacgccgcgagcgcgagccgcac
cggcgccgcccgatcgtcgagcacgccctcccagggcggtag

DBGET integrated database retrieval system