KEGG   Mycolicibacterium phlei: MPHLCCUG_02317Help
Entry
MPHLCCUG_02317    CDS       T04305                                 

Gene name
geoB_2
Definition
(GenBank) Geranial dehydrogenase
Organism
mphl  Mycolicibacterium phlei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AMO61130
LinkDB All DBs
Position
complement(2383829..2385277)
Genome map
AA seq 482 aa AA seqDB search
MRSLVYDDLFIGGRWRKPATSERISVISPHTEEPIGEVPHASPADVDRAVQAARAAFDEG
PWPRLDVDERIAAVERLAALYAEHTDEMADLITAEMGSPRSFSRMGQATGAVAQMYLNID
LARDFPWVERRLGLFGDAHIRRAPVGVVAAIVPWNVPQFLIMPKLIPALLAGCTVVVKPA
PETPIDAMWLAEMLDEIGLPEGVVSILPGGRETGEALVRHPGVDKVAFTGSSATGQRIAA
ICGEQLKRVSLELGGKSAAIILDDADIDHTVEQLRTASLMNNGQACVAQTRILVSPRRHD
DVVDGLATMMSGLNVGDPADETTDIGPLVSQRQQQRVLGYIRSGVEEGARIVVGGTDSPR
DRGWYVRPTLFADATNKMTIAREEIFGPVLTVLTYHDEDDAVRIANDSDYGLAGSVWTAD
TAHGLQIAARIRTGTYGVNMYTLDTTMPFGGFKKSGIGREFGVEGLSEYVELQTTICAEP
LS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcgatccctggtgtacgacgacctcttcatcggaggccggtggcgaaaacctgcgacg
tccgaacgcatcagcgtgatctcgccgcacaccgaggaaccgatcggcgaggtaccgcac
gcgtcacccgccgacgtcgaccgcgccgtccaggccgcccgcgccgcgttcgatgagggg
ccgtggccgcggctggacgtcgacgagcggatcgccgcggtcgagcgactggccgcgctg
tacgccgaacacaccgatgagatggctgatctcatcaccgcggagatgggctcgccccgc
agcttcagccggatgggtcaggccaccggagcggtggcgcagatgtacctgaacatcgat
ctcgcgcgcgacttcccgtgggtggagcgccggctcggcctgttcggcgacgcccacatc
cggcgcgcaccggtcggtgtggtggccgcgatcgtgccgtggaacgtgccgcagttcctg
atcatgccgaagctgatccccgccctgctggccggctgcacggtggtggtcaaacccgcg
cccgagacgccgatcgacgcgatgtggctggccgagatgctcgacgagatcggcctgccc
gagggggtggtgtcgatcctgccgggcggccgggagaccggcgaggcgctggtgcgccat
cccggggtggacaaggtcgcgttcaccggatcgtcggcgaccgggcagcgcatcgccgcg
atctgcggcgagcagctcaagcgggtgagcctggagttgggcggtaagtcggcggcgatc
atcctcgacgacgccgacatcgaccacaccgtcgaacagctcaggacggccagcctgatg
aacaacgggcaggcctgcgtggcgcagacgcggatcctggtcagcccccgcaggcacgac
gacgtggtcgacgggctggccacgatgatgtccgggctgaacgtcggcgacccggccgac
gagaccaccgacatcggcccgctggtgtcccagcgccagcagcagcgcgtactgggctac
atccggtcgggtgtcgaggagggtgcgcgaatcgtggtgggcggcaccgattctccgcgt
gatcgcggctggtacgtgcggcccaccctgttcgccgatgccaccaacaagatgacgatc
gcccgcgaggagatcttcggcccggtgctgaccgtgctcacctaccacgacgaggacgac
gcggtacgcatcgccaacgacagcgactacggtctggccgggtcggtgtggaccgccgac
accgcgcacggcctgcagatcgccgcccggatccgcacgggcacttacggagtcaacatg
tacacgctcgacaccacgatgccgttcggcgggttcaagaagtccggtatcgggcgggag
ttcggagtcgaggggctctcggagtacgtggagctgcagaccacgatctgcgcggagccg
ctgtcctag

DBGET integrated database retrieval system