KEGG   Mycolicibacterium phlei: MPHLCCUG_02903Help
Entry
MPHLCCUG_02903    CDS       T04305                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00620  Pyruvate metabolism
mphl00680  Methane metabolism
mphl01100  Metabolic pathways
mphl01120  Microbial metabolism in diverse environments
mphl01200  Carbon metabolism
Module
mphl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mphl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPHLCCUG_02903 (ppc)
  Energy metabolism
   00680 Methane metabolism
    MPHLCCUG_02903 (ppc)
Enzymes [BR:mphl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MPHLCCUG_02903 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DZF DUF2721
Motif
Other DBs
NCBI-ProteinID: AMO61712
LinkDB All DBs
Position
complement(2963517..2966312)
Genome map
AA seq 931 aa AA seqDB search
MTDVPGLEPIGAVKRTRVGREATEPMREDIRLLGALLGDTVREQNGEEVFDLVERARVES
FRVRRSEIDRADLARMFDGIDVHQAIPVIRAFTHFALLANVAEDIHRERRRAIHTAAGEP
PQNSSLAATYAKLDAADLDPRTVAEALSGALVSPVITAHPTETRRRTVFDTQHRITELMR
LRLHGHTRTDDGRDIELELRKHILTLWQTALIRLSRLKIQDEIETGLRYYPAAFFEVIPE
VNAEVRKELRSRWPDAELLTEPIVRPGSWIGGDRDGNPNVTADVVRLATGNAAYTAFNHY
FTELTALQEELSMSARLVRISDELAALADRCDEPARADEPYRRALRVVHARLTATAQEIL
DRQPEHELDLGMQRYATPAELLADLDVIDASLRANGSTVLADDRLARLREAVHVFGFHLC
GLDMRQNSEVHEEVVAELLAWAGVHPDYRSLEEPDRVELLARELSTRRPLIKEGAELSEL
ARKELDIMAAAARAVRVYGPAAVPNYIISMCQSVSDMLEAAILLKEVDLLDVSAEQAYAP
VGIVPLFETIDDLQRGAGILEAALELPVYRAIVSARGQNQEVMLGYSDSNKDGGYLAANW
ALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVNGSLRITEQGE
VIAAKYAEPQLAHRNLETLVAATLEATLLDVEGLGDEAGPAYEVLDDLAARAQRAYSELV
HETPGFVEYFKASTPVSEIGALNIGSRPTSRKPTTSISDLRAIPWVLAWSQSRVMLPGWY
GTGTAFEEWIAAGPEQERVEVLRDLYRRWPFFRTVLSNMAQVLAKSDLGLAARYSELVED
EALRRRVFDKIAAEHERTIRMHKLITGHDDLLADNPALARSVFNRFPYLEPLNHLQVELL
RRYRSGDDDELVQRGILLTMSGLATALRNSG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgtccccgggctggaaccgatcggcgcggtcaagcgcacccgtgtcggccgt
gaggccaccgaaccgatgcgcgaggacatccgcctgctgggcgcgctgctcggcgacacc
gtgcgcgagcagaacggcgaggaggtgttcgacctcgtcgagcgggcccgggtggagtcg
ttccgggtgcgccgctcggagatcgaccgggccgatctggcgcgcatgttcgacggcatc
gacgtgcaccaggcgatcccggtcatccgggcgttcacgcacttcgcgctgctggccaac
gtcgccgaggacatccaccgggagcgcaggcgcgcgatccacacggcggccggcgagccg
ccgcagaacagcagcctggccgcgacgtacgccaaactcgacgcggccgatctggatccg
cggaccgtcgccgaggcgctgagcggtgcgctggtgtcgccggtgatcaccgcgcacccc
accgagacgcgtcgtcgcaccgtcttcgacacccagcaccggatcaccgagctgatgcgg
ctgcggctgcacggtcacacccgcaccgacgacgggcgcgacatcgagctcgaactgcgc
aagcacattctgacgctgtggcagaccgcgctgatccggttgtcccggttgaagatccag
gacgagatcgagaccggcctgcgctactacccggcggcgttcttcgaggtgatccccgag
gtcaacgccgaggtgcgtaaggagctgcggtcgcggtggcccgacgccgagctgctgacg
gagccgatcgtgcggcccgggtcgtggatcggcggcgaccgcgacgggaacccgaacgtc
accgccgacgtggtgcggctggccaccggaaacgccgcgtacacggcgttcaaccactac
ttcaccgagctcaccgcgcttcaggaggagctgtcgatgtcggcgcggctggtgcggatc
agcgacgagctggccgcgctggccgaccggtgcgacgagcccgcccgcgccgacgagccg
taccggcgggcgctgcgcgtcgtgcacgcccgcctgaccgcgacggcccaggagatcctg
gaccggcagcccgaacacgaactcgacctcggcatgcagcggtacgcgacgccggcggag
ctgctcgccgacctcgacgtcatcgacgcctcgctgcgcgccaacggcagcacggtgctc
gccgacgaccggctggcccggctgcgggaagccgtgcacgtgttcggttttcatctgtgc
ggactcgacatgcggcagaactccgaggtgcacgaggaggtcgtggccgagctgctggcc
tgggccggggtgcacccggattaccgctcgctggaggagcccgaccgggtggagctgctg
gcccgcgagctgtcgacccggcgcccgctgatcaaggagggggccgagctgtcggagctg
gcccgcaaggagctcgacatcatggcggccgccgcgcgtgcggtgcgggtgtatgggccg
gcggcggtgccgaactacatcatctcgatgtgccagtcggtgtcggacatgctcgaggcc
gcgatcctgctcaaagaggttgacctgctggatgtctcggctgagcaggcctatgcgccg
gtcgggatcgtgccgttgttcgagacgatcgacgacctgcagcgcggtgcggggatcctg
gaggccgcgctggagctgccggtgtaccgggcgatcgtgtcggcgcgcgggcagaaccag
gaggtgatgctgggctactccgactccaacaaggacgggggatacctggcggccaactgg
gcgctgtaccgcgccgagctcgacctggtggagtcggcgcgcaagaccggaatccggttg
cggctcttccacggtcgcggcggcacggtgggccgcggcggcgggccgagctacgacgcg
atcctggcgcagccgccgggggcggtgaacgggtcgctgcgcatcaccgagcagggtgag
gtgatcgcggccaagtacgccgagccgcaactggcgcaccgcaacctggagacgctggtg
gcggcgacgctggaggccacgctgctcgacgtggagggtctgggcgacgaggccggcccg
gcctacgaggtgctcgacgacctggccgcccgcgcgcagcgcgcgtactccgaactggtg
cacgagacaccgggtttcgtcgagtacttcaaggcgtccacaccggtgagcgagatcggg
gcgctgaacatcggcagccgtccgacgtcgcgcaagccgacgacgtcgatctcggatcta
cgggcgattccgtgggtactggcgtggagccagtcgcgggtgatgctgcccggctggtac
ggcacgggcacggcgttcgaggagtggatcgccgcgggtccggagcaggagcgggtggag
gtgctgcgcgacctgtaccggcgctggccgttcttccgcacggtgctgtcgaacatggcg
caggtgctggcgaagtccgatctgggcctggccgcgcggtattcggaactggtcgaggac
gaggcgctgcggcggcgggtgttcgacaagatcgccgccgagcatgagcgcaccatccgg
atgcacaagctgatcaccggtcacgacgatctgctcgccgacaacccggcgctggcacgc
tcggtgttcaaccgcttcccgtatctggaaccgctgaatcacctgcaggtggagctgctg
cggcggtaccgctccggtgacgacgacgagttggtgcagcggggaatcctgctcacgatg
agcggcctggcgaccgcgctgcgcaacagcggctag

DBGET integrated database retrieval system