KEGG   Mycolicibacterium phlei: MPHLCCUG_03582Help
Entry
MPHLCCUG_03582    CDS       T04305                                 

Gene name
dhaK_2
Definition
(GenBank) PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK
  KO
K20901  L-erythrulose 1-kinase [EC:2.7.1.209]
Organism
mphl  Mycolicibacterium phlei
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MPHLCCUG_03582 (dhaK_2)
Enzymes [BR:mphl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.209  L-erythrulose 1-kinase
     MPHLCCUG_03582 (dhaK_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Dak2
Motif
Other DBs
NCBI-ProteinID: AMO62383
LinkDB All DBs
Position
complement(3645402..3647117)
Genome map
AA seq 571 aa AA seqDB search
MTYLLNSPGDFADEAVRGLVAAHPDLLVAVPGGVVRASTTPKGQPALVIGGGSGHYPAFA
GWVGPGMGHGAPCGNIFSSPSASEVYSVVRNAENGGGVLLGFGNYAGDVLHFGLAAEKLR
HEGIDVRIVTVSDDIASNSPDNHRDRRGVAGDLPVFKIVGAAIESGADLDEAERIAWKAN
DATRSFGVAFDGCTLPGAREPLFHVEDGSMALGLGIHGEPGVRDTRLGTAAEVADLLFDQ
VIAEEPPRGKNGYDGRVAVILNGLGTVKYEELFVVYTRIAERLAQHGLTAVRPEVGEFVT
SLDMAGVSLTMVFLDDELERHWTAPVETPAYRRGAMPAVERPARTEIWDVGAVEIPEATA
DSRECARRIVTVLEAFENVCAENEAELGRIDAVAGDGDHGQGMTFGSRGAAQAARDAVDR
SAGARTTLLLAGQAWADAAGGTSGALWGAALTSAGGVFSDTAGCDDRTVVDAVRAGIDAV
LRLGGAKPGDKTMVDAAVPFRDALTEASDTKAGAAIATAAQVAREAAQKTAEFPARRGRA
RVLGDKSVGTPDPGAVSFALLMKTLGEQLSQ
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacgtacctcctgaactccccgggtgacttcgccgacgaggcggtccgcggtctggtg
gccgctcatcccgacctcctcgtggcggtgcccgggggtgtcgtgcgcgcgagcaccacc
ccgaagggacaacccgcgctggtgatcggcggcgggtcaggccactatcccgccttcgcg
ggatgggtcggaccgggcatgggccacggcgcaccctgcggcaacatcttctcctcgccg
tccgcctccgaggtctactcggtggtgcgcaacgccgagaacggcggcggcgtcctgctc
ggcttcggcaactacgccggcgacgtactgcacttcgggctggcggccgagaagctgcgg
cacgagggcatcgacgtgcggatcgtgaccgtcagcgacgacatcgcgtccaacagcccg
gacaaccaccgcgacaggcgaggtgtcgccggggacctgccggtcttcaagatcgtcggc
gccgcaatcgaatccggtgccgacctcgacgaagccgagcggatcgcctggaaggccaac
gacgcgacgcggtcgttcggggtggctttcgacgggtgcaccctgcccggcgcccgggag
ccgctgttccacgtcgaggacggctcgatggcgctggggctgggcatccacggtgaaccc
ggcgtccgcgacacccggctcggcaccgccgccgaggtggccgacctgctgttcgatcag
gtcatcgccgaggaaccgccgcgcgggaagaacgggtacgacggccgggtggcggtgatc
ctcaacgggttgggcaccgtcaagtacgaagagctgttcgtcgtctacacccggatcgcc
gagcgtctcgcccagcacggcctgaccgcggtgcggcccgaggtcggcgagttcgtcacc
agcctcgacatggccggcgtgtcgctgacgatggtcttcctcgacgacgaactcgagcgg
cactggaccgccccggtcgagaccccggcgtaccgacgcggcgccatgcccgccgtcgag
cgcccggcgcgcaccgagatctgggacgtcggcgccgtcgaaatccccgaggccactgcg
gattcccgcgagtgcgcccgccgcatcgtcaccgtactcgaggcgttcgagaacgtgtgc
gccgagaacgaggccgaactggggcgcatcgacgcggtcgccggcgacggcgaccacggc
cagggtatgacgttcggatcccgcggcgccgcgcaggctgcccgcgacgccgtcgaccgc
agcgcaggcgcgcgcaccaccctgctgctggccgggcaggcctgggccgacgcggcgggc
ggaacctccggtgccttgtggggtgcggcgctgaccagcgccggtggcgtgttctccgac
accgcgggctgcgacgaccggaccgtcgtcgacgcggtgcgggccggcatcgacgccgtg
ctgcggctcggcggcgcaaagccgggggacaagacgatggtcgacgccgccgtgccgttc
cgggatgccctgaccgaggcgtccgacacgaaggcgggcgcggcgatcgcgacggccgcg
caggtggcccgcgaggcggcgcagaagaccgcggagttccccgctaggcggggccgcgcg
cgggtactcggagacaagagcgtcggcacacccgaccccggcgcggtgtcgttcgcgctg
ttgatgaagacgctcggtgagcagctgtctcagtga

DBGET integrated database retrieval system