KEGG   Mycolicibacterium phlei: MPHLCCUG_04577Help
Entry
MPHLCCUG_04577    CDS       T04305                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mphl  Mycolicibacterium phlei
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MPHLCCUG_04577 (ahpF)
Enzymes [BR:mphl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MPHLCCUG_04577 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored DAO AlaDh_PNT_C Glutaredoxin Thi4 FAD_binding_3 K_oxygenase FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AMO63363
LinkDB All DBs
Position
4656754..4658325
Genome map
AA seq 523 aa AA seqDB search
MLDASTTAQLKTYLEKVTTPIELVASLDDSPKSAELAALLEETAALSDKVTYRRADDDAR
RPSFRIERVGTDIRVQFAGLPMGHEFSSYVLALLQVGGHPVKVSDELADTIKSLDGDYQF
ETYMSLSCQNCPDVVQALNAMSVLNPRIRVVAIDGALFQDEVEARKVLAVPTVYLNGELF
DSGRMSIEQIVAKLDTGAAARDAEKMKGKAPFDVLVVGAGPAGATAAIYAARKGLRTGMA
AERIGGQVLDTMAIENFISVPHTEGPKLAAALEEHVREYDVDIMPMQEAVELIPALEEGG
LTEIRFRNGATLSARSVVLATGARWRNMNVPGEQEYRNKGVTFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVGHVTLLEFDTKLRADAVLQRKLHSLPNVDVILNAATTEVVGDG
TQVTGLRYRDRDTDEQHELALEGVFVQIGLLPNTEWLKGTLELTDRGEVVVNAAGATSAP
GVFAAGDCTTTPYKQIVIALGAGATASLSAFDHLIRTSAPTAG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctcgaccaccgcacagctgaagacctacctggagaaggtcaccacgccg
atcgaactggtggcctccctcgacgacagccccaagtccgcggaactcgccgcgctcctc
gaggagaccgcggcgctgtccgacaaggtgacctaccgccgcgccgacgacgacgcacgc
cgtccgtcgttccgcatcgagcgggtgggcaccgacatccgggtgcagttcgccggcctg
ccgatgggccacgagttcagctcctacgtcctggcgctgctgcaggtgggcgggcatccg
gtcaaggtctccgacgaactggccgacaccatcaagtcgctcgacggtgactaccagttc
gagacgtacatgtcgctgtcgtgccagaactgcccggacgtcgtccaggcgctcaacgcg
atgagcgtgctcaacccgcgcatccgggtggtcgccatcgacggcgccctgttccaggac
gaggtcgaggcgcgcaaggtgctcgcggtgcccaccgtctacctcaacggtgaactgttc
gactccggccggatgagcatcgagcagatcgtcgccaagctcgacaccggcgccgccgcc
cgcgacgccgagaagatgaagggcaaggccccgttcgacgtgctcgtcgtcggcgccggc
ccggcgggcgccaccgccgccatctacgccgcccgcaagggtctgcgcaccggtatggcc
gccgagcggatcggcggtcaggtgctcgacaccatggcgatcgagaacttcatctcggtg
ccgcacaccgagggccccaagctggccgccgcgctcgaggagcacgtccgcgagtacgac
gtcgacatcatgccgatgcaggaggcggtcgagctgatccccgctctcgaggagggcggc
ctgaccgagatccgcttccgcaacggcgccacgctgtcggcccgctcggtggtgctcgcc
accggcgcccgctggcgcaacatgaacgtccccggcgagcaggagtaccgcaacaagggc
gtcaccttctgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgccgtcatc
ggcggcggtaactccggcgtcgaggccgccatcgacctggccggtgtggtcggccacgtc
acgctgctggagttcgacaccaagctgcgcgccgacgcggtcctgcagcgcaagctgcac
agcctgcccaacgtcgacgtcatcctcaacgccgccaccaccgaggtcgtcggcgacggc
acccaggtgaccgggctgcgctaccgggaccgcgacaccgacgagcagcacgagctcgcg
ctcgagggcgtcttcgtccagatcggtctgctgcccaacaccgagtggctcaagggcacg
ctcgagctgaccgaccgcggcgaggtcgtcgtcaacgccgcgggcgccacctcggcgccg
ggtgtgttcgcggccggcgactgcacgaccacgccgtacaagcagatcgtcatcgcgctg
ggtgccggcgcgaccgcgtcgctgagcgccttcgaccatttgatccgcacgtccgcgccg
actgccggttga

DBGET integrated database retrieval system