KEGG   Mycolicibacterium phlei: MPHLCCUG_04717Help
Entry
MPHLCCUG_04717    CDS       T04305                                 

Gene name
alaA
Definition
(GenBank) Glutamate-pyruvate aminotransferase AlaA
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00220  Arginine biosynthesis
mphl00250  Alanine, aspartate and glutamate metabolism
mphl00290  Valine, leucine and isoleucine biosynthesis
mphl01100  Metabolic pathways
mphl01110  Biosynthesis of secondary metabolites
mphl01130  Biosynthesis of antibiotics
mphl01210  2-Oxocarboxylic acid metabolism
mphl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPHLCCUG_04717 (alaA)
   00290 Valine, leucine and isoleucine biosynthesis
    MPHLCCUG_04717 (alaA)
   00220 Arginine biosynthesis
    MPHLCCUG_04717 (alaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mphl01007]
    MPHLCCUG_04717 (alaA)
Enzymes [BR:mphl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MPHLCCUG_04717 (alaA)
    2.6.1.66  valine---pyruvate transaminase
     MPHLCCUG_04717 (alaA)
Amino acid related enzymes [BR:mphl01007]
 Aminotransferase (transaminase)
  Class I
   MPHLCCUG_04717 (alaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Alliinase_C Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMO63503
LinkDB All DBs
Position
4814429..4815703
Genome map
AA seq 424 aa AA seqDB search
MEGVTTQHVPSQAAGHHPRPRTFTQSSKLQDVLYEIRGPVHEHAARLEAEGHRILKLNIG
NPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGILSARRAVFTRYELVEGFPKFDVDDVYL
GNGVSELIQMVLQALLDNGDQVLIPAPDYPLWTACTSLAGGTPVHYLCDETQGWQPDLAD
LESKITERTKAIVVINPNNPTGAVYTREVLEQIANLARKHQLMLLADEIYDKILYDDAKH
ISMAAVAPDVLTLTFNGLSKTYRVAGYRSGWLVITGPKDHATSFIEGISLLANMRLCPNV
PAQHAIQVALGGHQSIDDLVLPGGRLREQRDVAWEKLNEIPGVSCVKPQGALYAFPRLDP
EVYDIVDDEQLVLDLLLQEKILVTQGTGFNWPTPDHLRIVTLPWARDLAAAIERLGNFLV
SYRQ
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgtgacgacccaacacgtgcccagccaggccgcgggacaccacccgcggcct
cgcacgttcacgcagtcttcgaagctgcaggacgtgctctacgagatccgcggcccggta
cacgagcacgcggcccggctggaggccgagggtcatcggatcctcaagctgaacatcggc
aaccccgccccgttcggcttcgaggcgcccgacgtgatcatgcgcgacatcatccaggcg
ctgccgtacgcgcaggggtactccgactccaagggcatcctgtcggcacggcgcgcggtg
ttcacccgctacgagctggtggaggggttcccgaagttcgacgtcgacgacgtctatctc
ggcaacggggtctccgagctgatccagatggtgctgcaggccctgctggacaacggcgat
caggtgctgatccccgcccccgactacccgctgtggaccgcgtgcacgtcgctggccggc
ggcaccccggtgcactacctgtgcgacgagacgcagggctggcagccggatctggcggat
ctggagtccaagatcaccgagcgcaccaaggcgatcgtggtgatcaacccgaacaacccg
accggcgccgtctacacccgcgaggttctcgagcagatcgcgaacctcgcgcgcaagcac
cagctgatgctgctggccgacgagatctacgacaagatcctctacgacgacgccaagcac
atctcgatggcggcggtggccccggacgtgctgaccctgacgttcaacggcctgtcgaag
acctaccgggtcgccggctaccgctcggggtggctggtgatcaccggcccgaaggaccac
gcgaccagtttcatcgagggcatcagcctgctggccaacatgcggctgtgcccgaatgtg
cctgcgcagcacgcgattcaggtcgcactcggcggtcaccagagcatcgacgacctggtg
ttacccggcggcaggctgcgtgagcagcgggacgtcgcctgggagaagctcaacgagatc
cccggggtgtcgtgcgtgaaaccgcagggcgcgctgtacgcgttcccgcggctggacccc
gaggtctacgacatcgtcgacgacgagcagctggtgctggatctgcttctgcaggagaag
atcctggtcacccagggcaccgggttcaactggcccacccccgaccacctgcgcatcgtg
acgctgccgtgggcccgcgacctggccgccgcgatcgaacggctcggcaacttcctggtg
tcctaccgccagtaa

DBGET integrated database retrieval system