KEGG   Mycolicibacterium phlei: MPHLCCUG_04874Help
Entry
MPHLCCUG_04874    CDS       T04305                                 

Definition
(GenBank) putative methyltransferase
Organism
mphl  Mycolicibacterium phlei
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Ubie_methyltran AdoMet_MTase Methyltransf_32 FtsJ
Motif
Other DBs
NCBI-ProteinID: AMO63659
LinkDB All DBs
Position
4992795..4993586
Genome map
AA seq 263 aa AA seqDB search
MAVTDRFAKRATLRRSVRLLSEFRFEQSDPARFYGALADDTAALVADLWQGAHGTAPSGQ
TVLDVGGGPGYFSDAFAAKGFHYIGVEPDPAEMHAGPAVEAKATYLRASGMALPIADGSV
DVCLSSNVAEHVAQPWRLGAEMLRVTRPGGLVVLSYTVWLGPFGGHETGLWHYLGGARAA
RRYTRRHGHPPKNNYGSSLFAVSAADGLSWAASTGALVAAFPRYHPRWAWWMTAVPVFRE
FAVSNLVLVLRPPIGTSSNPRRT
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcacagaccggttcgccaagcgggcgaccctgcgccggtcggtgcgcctgctc
tcggagttccggttcgagcagagcgacccggcccgcttctacggtgcactggccgacgac
accgcggcgctggtcgccgacctgtggcagggcgcgcacggcaccgcgccgtcgggccag
accgtgctcgacgtcggcggcggccctggatacttctcggatgcgttcgccgccaagggg
tttcactatatcggcgtggaaccggacccggccgagatgcacgccgggccggccgtcgag
gccaaggccacctacctgcgggcgtccgggatggcgctgcccatcgccgacggcagcgtc
gacgtctgcctgtcgagcaacgtcgccgagcacgtcgcgcaaccctggcggttgggcgcc
gagatgctgcgggtcacccgccccggcggcctggtggtgctgtcctacaccgtatggctg
ggcccgttcggcggtcacgagaccgggctgtggcactatctcggcggcgctcgcgcggcc
cgccgctacacccgcaggcacggtcatccacccaagaacaactacggctcgtcactgttc
gcggtgtcggcggccgacgggctttcctgggccgccagcaccggcgccctggtggccgca
tttccccgctaccacccgcgatgggcctggtggatgacggcggtgccggtgtttcgcgag
ttcgcggtgagcaacctggtgctggtcctgcggccgccgattggaacaagttctaatccg
agacgaacctag

DBGET integrated database retrieval system