KEGG   Methylobacterium phyllosphaerae: MCBMB27_01239Help
Entry
MCBMB27_01239     CDS       T04968                                 

Definition
(GenBank) trehalose synthase/amylase TreS
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00500  Starch and sucrose metabolism
mphy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MCBMB27_01239
Enzymes [BR:mphy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MCBMB27_01239
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MCBMB27_01239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH Mak_N_cap hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: APT30530
LinkDB All DBs
Position
complement(1327265..1330543)
Genome map
AA seq 1092 aa AA seqDB search
MIDRSDPQWYRDAIIYQIHVKSFFDSNNDGIGDFEGLTQRLDYVRDLGVTAIWLMPFYPS
PLRDDGYDIADYRDINPSYGTMEAFKAFVEAAHARGLRVITELVINHTSDQHPWFQAARE
APPGSPERNFYVWSDTDEPYRDTRIIFLDTEASNWTWDPVAKQYFWHRFYSHQPDLNFDN
PAVLEAVIEVMRYWLDMGVDGLRLDAIPYLIERDGTNCENLAETHDVIKKIRAALDASYP
DRMLLAEANQWPEETAQYFGDGDECHMAFHFPLMPRMYMAIAREDRHPITDIMRQTPEIP
EGCQWAIFLRNHDELTLEMVTAEERDYLWSFYAAERRARINLGIRRRLAPLLENDRRKIE
LMKSLVLSMPGTPVLYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRANPQKLFLP
AIQDPIYGFDAINVEAQTQAQTSLLNWTRRMIAIRNNSVALGRGTIQFLYPSNRKVLAWI
REHEDERILCVANLSRAPQAVQLDLSELRTAVPIELTGGTEFPPIGDLPYLLTLPSYGFY
WFSLSAARSGVVGPQQEPPELFTLVLTGGIETLMSGRERVAFERTVVPPFLTSRRWFGAK
GSRIKATKVVDCAALKDVDGSARFLLPRLQVQLANGESHEYFMPVGVEEGREDEALMPFA
VARVRRGPRTGLLYGAAGSNDFAACLIDDMRQGRVIPTESGRLVFAVTSAFDPEVTVDVA
DIRRLSAEQSNTSIAVGSKMMLKLLRRLQPGLHPEIEVGRFLTEQAGFSNTPALLGTLEH
VAEDGTRTALAILQKFVVNQGDAWTLMLEGLRRDFETVVLTPESEAASPEEAFQAHRPWA
DLLGRRTAELHAALAIETDDPAFAAEPFTGDDLAVLARDARHQAERAFRALKGLADRGLD
AGKPACAELGQRRGEVEALIAALTAEPVRGAHKTRIHGDYHLGQVLVAENDLIIVDFEGE
PSRPADERRAKSMPLRDVAGLMRSFAYGAETVIREITARFADSEGRARDAATAWRGMIEA
AFLAGYESAVEGSRAAVTDLGSRARLLRLCLLTKALYEVDYEANNRPDWIEIPARGVLTI
LDTDGHEPGALE
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgcagcgacccgcaatggtaccgtgacgccatcatctaccagatccacgtc
aagtcgttcttcgactcgaacaacgacgggatcggcgacttcgagggcctgacccagcgc
ctcgactatgtccgcgatctcggcgtcacggcgatctggctgatgccgttctatccctcg
ccgctccgcgacgacggctacgacatcgccgattaccgggacatcaacccgtcctacggg
accatggaggccttcaaggccttcgtggaggcggcgcacgcccggggcctgcgggtcatc
accgaactcgtgatcaaccacacgagcgaccagcacccctggttccaggccgcccgcgag
gcgccccccggctcgccggagcgcaacttctacgtctggtcggacaccgacgagccgtac
cgggacacgcggatcatcttcctcgataccgaggcgtccaactggacctgggacccggtg
gccaagcagtatttctggcaccggttctacagccaccagccggacctgaacttcgacaac
ccggcggtgctcgaggccgtcatcgaggtgatgcgctactggctcgacatgggcgtcgac
ggcctgcgcctcgacgcgatcccctacctgatcgagcgcgatggcacgaactgcgagaac
ctcgccgagacccacgacgtcatcaagaagatccgcgccgccctcgatgccagctacccc
gaccggatgctgctggccgaggccaaccagtggccggaggagaccgcccagtatttcggc
gacggcgacgaatgccacatggcgttccacttcccgctgatgccgcggatgtacatggcg
atcgcccgggaggaccggcacccgatcaccgacatcatgcgccagaccccggagatcccg
gagggctgccaatgggcgatcttcctgcgcaaccacgacgagctgacgctcgaaatggtc
accgccgaggagcgtgactacctctggtcgttctacgccgcagagcgccgcgcccggatc
aatctcggcatccgccgccgcctcgcgccgctcctcgagaacgaccggcgcaagatcgag
ttgatgaagtccctcgtcctgtcgatgcccggcacgccggtgctctactacggcgacgag
atcggcatgggcgacaacatctatctgggcgaccgcgacggcgtgcgcacgcccatgcaa
tggtccccggaccgcaacggcggcttctcccgggcgaacccccagaagttgttcctgccg
gcgatccaggacccgatctacggcttcgacgccatcaacgtcgaggcgcagacccaggcg
cagacgagcctgctgaactggacgcggcgcatgatcgcgatccgcaacaacagcgtcgcc
ctcgggcgcggcacgatccagttcctctatcccagcaaccggaaggtcctggcctggatc
cgcgagcacgaggacgagcggatcctgtgcgtggcgaacctgtcgcgggcgccccaggcg
gtgcagctcgacctgtcggaactgcgcaccgcggtgccgatcgagctcaccggcggcacc
gagttcccgccgatcggcgatctgccctacctgctgaccctgccgtcctacggtttctac
tggttcagcttgagcgccgcgcgctccggggtggtcggcccgcagcaggagccgccggag
ctgttcaccctggtgctcaccggcgggatcgagaccctgatgagcgggcgcgagcgcgtc
gccttcgagcgcacggtggtgccgccgttcctgacgagccggcgctggttcggcgccaag
ggctcgcggatcaaggccacgaaggtggtcgactgcgccgccctgaaggacgtcgacggg
agcgcgcgcttcctgctgccgcggctgcaggtgcagctcgccaacggcgagagccatgag
tacttcatgccggtcggcgtcgaggagggccgcgaggacgaggcgctgatgcccttcgcg
gtggcgcgggtgcgccgcggcccgcggaccgggctgctctacggcgcggccggctccaac
gacttcgccgcctgcctcatcgacgacatgcgccagggccgtgtgatccccacggagagc
ggccgcctcgtcttcgccgtcacctcggccttcgacccggaggtcacggtcgacgtggcc
gatatccgccggctgtcggcggagcagagcaacacctcgatcgccgtcggctcgaagatg
atgctcaagctgctgcgccgcctgcagccggggctgcatcccgagatcgaggtcgggcgc
ttcctcaccgagcaggcgggtttctccaatacccccgccctgctcggcacgctggagcac
gtcgccgaggacgggacccggacggccctcgcgatccttcagaaattcgtcgtgaaccag
ggcgatgcctggaccctgatgctggagggcctgcgccgggacttcgagaccgtcgtgctc
acccccgagagcgaggccgccagccccgaggaggcgttccaggcccaccggccctgggcg
gatctgctcgggcggcgcaccgccgagctgcacgcggcgctggcgatcgagaccgacgat
ccggccttcgcggccgagccgttcaccggggacgatctcgcggtgctggcgcgcgacgcc
cgccaccaggcggagcgtgccttccgggcgctcaagggcctggccgaccgggggctcgat
gccggcaagccggcctgcgcggaactcggccagcgccggggcgaggtcgaggccctgatc
gccgcgctcaccgccgagccggtccggggcgcccacaagacccgcatccacggtgactac
cacctgggacaggtgttggtcgccgagaacgacctgatcatcgtcgacttcgagggcgag
ccctcgcgtccggccgacgagcgccgggccaagtcgatgcccctgcgggacgtcgccggg
ctgatgcgctccttcgcgtacggcgccgagacggtgatccgggagatcaccgcccggttc
gccgattccgaggggcgggcgcgggacgccgccacggcgtggcgcggcatgatcgaggcg
gcgttcctcgccggctacgagtccgcggtggagggctcgcgcgccgccgtgaccgacctg
ggaagccgggcgcggctgctgcgcctctgcctgctgaccaaggccctgtacgaggtcgat
tacgaggccaacaaccggccggactggatcgaaatccccgcccgtggggttctgaccatt
ctggacacggacggacacgagcccggagcattggaatga

DBGET integrated database retrieval system