KEGG   Methylobacterium phyllosphaerae: MCBMB27_01782Help
Entry
MCBMB27_01782     CDS       T04968                                 

Definition
(GenBank) inner membrane protein YecN
  KO
K07136  uncharacterized protein
Organism
mphy  Methylobacterium phyllosphaerae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-ProteinID: APT31073
LinkDB All DBs
Position
complement(1923104..1923502)
Genome map
AA seq 132 aa AA seqDB search
MIFPATTAVFAGLLALVYLGLSGWVMASRVSGNVLFGDGGDETMLKRVRSHANFAEYVPL
ALIVIGLLEASGGGHTLVQALLIALLVGRILHPIGMFAPPNSPRQFACRGGGILLTMAAL
AIAAIALLLRVA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgatcttccccgcgaccacggccgtctttgccgggctgctcgccctcgtgtacctcggc
ctctcgggctgggtgatggcgagccgcgtctccggcaacgtgctgttcggggacgggggc
gacgagacgatgctcaagcgcgtccgctcgcacgccaatttcgcggaatacgtgcccctg
gcactcatcgtcatcggccttctcgaggcgagcggcggcggccacactctggtccaggcc
ctgctgatcgccctgctggtcggccggatcctgcacccgatcgggatgttcgcgcccccg
aactccccgcgccagttcgcctgccggggcggcggcatcctgttgacgatggcggctttg
gccatcgcggcgatcgcgctgctgctgcgggtggcctag

DBGET integrated database retrieval system