KEGG   Methylobacterium phyllosphaerae: MCBMB27_02079Help
Entry
MCBMB27_02079     CDS       T04968                                 

Definition
(GenBank) transcriptional regulatory protein OmpR
  KO
K02483  two-component system, OmpR family, response regulator
Organism
mphy  Methylobacterium phyllosphaerae
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mphy02022]
    MCBMB27_02079
Two-component system [BR:mphy02022]
 OmpR family
  Unclassified
   MCBMB27_02079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: APT31370
LinkDB All DBs
Position
complement(2239951..2240706)
Genome map
AA seq 251 aa AA seqDB search
MMQAEPLTDSFAMNAPATPHILVVEDDREISALIARYLRGNDCRVTLAGDGAEMDRVLAE
ARIDLIVLDLMLPGEDGLSLCKRLRGTSQIPILILTAKSEEVDRILGLELGADDYLAKPF
NPRELLARIRAILRRVAAEAPDADERRRLHFSGWTLDVSLRQVLSPEGARISITGAEFDL
LHALCLRPGRVLSRDQLLDLTQGRSAGPFERSIDVLISRIRQKIERDTRNPEFIRTIRSG
GYLFTPEVTRS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggccgaaccgctgaccgattccttcgcgatgaacgcacccgcaacaccccac
atcctcgtggtcgaggacgatcgagagatctcggccctgatcgcgcgctacctgcgcggc
aacgattgccgggtcacgctggcgggtgacggggccgagatggaccgggtccttgcggaa
gcgcggatcgacctgatcgtcctcgacctgatgcttcccggcgaggacggactgagcctg
tgcaagcgcctgcgcggcacgtcgcagatcccgatcctgatcctgacggcgaaatccgag
gaggtggaccggatcctcggcctggagctcggcgccgacgattacctcgccaagccgttc
aacccacgggagctgctcgcccgcatccgcgcgatcctgcggcgggtcgcggccgaggcc
cccgacgcggacgagcggcggcggctgcatttctcgggctggacgctcgacgtgtccctg
cgccaggttctgtcccccgagggcgcccgcatctcgatcaccggggcggagttcgatctc
ctgcacgccctttgcctccggcccgggcgggttctgtcgcgggaccaactcctcgacctc
acgcagggccgctccgccggcccgttcgaacgcagcatcgacgtgctgatctcccggatc
cgtcagaagatcgagcgcgacacccgcaatccggaattcatccgcacgatccggtcgggc
ggctatctgttcacgccggaggtcacgcggtcatga

DBGET integrated database retrieval system