KEGG   Methylobacterium phyllosphaerae: MCBMB27_02127Help
Entry
MCBMB27_02127     CDS       T04968                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00061  Fatty acid biosynthesis
mphy01100  Metabolic pathways
mphy01212  Fatty acid metabolism
Module
mphy_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MCBMB27_02127
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mphy01004]
    MCBMB27_02127
Enzymes [BR:mphy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     MCBMB27_02127
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     MCBMB27_02127
Lipid biosynthesis proteins [BR:mphy01004]
 Fatty acid synthase
  Component type
   MCBMB27_02127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: APT31418
LinkDB All DBs
Position
complement(2288884..2289420)
Genome map
AA seq 178 aa AA seqDB search
MPPDAETQAQDANRRSHYSYEDLLACGRGELFGSGNAQLPLPPMLMFDRITSIAAEGGAH
GKGHVTAELDIRPDLWFFPCHFQGDPVMPGCLGLDALWQMLGFHLGWLGSPGRGRALGVG
EVKLAGQVLPTMKKVVYNVDVKRVRQGKLVLGIGDGWLEADGERVYQVQDMRVGLFQS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagacgccgagacacaagcgcaggacgcgaaccgccggtcgcactattcttac
gaggatcttctggcctgcgggcgcggcgaactcttcggatccgggaacgcgcaattgccg
cttccgccgatgctgatgttcgaccgcatcacgtccatcgcggccgagggtggcgcccat
gggaagggccacgtgaccgccgaactcgacattcggccggacctctggttcttcccctgc
cactttcagggcgatccggtgatgccgggctgcctcgggctcgatgcgctctggcagatg
ctgggcttccatctcggctggctcggctcgccgggtcgtggccgcgccctcggcgtcggc
gaggtgaagctcgccggccaagtcctgccgacgatgaagaaggtggtctacaatgtcgac
gtgaagcgcgtccgtcagggcaagctcgtcctcggcatcggcgacggctggctcgaagcg
gacggcgagcgcgtctatcaggttcaggacatgcgggtcggcctgttccagagctga

DBGET integrated database retrieval system