KEGG   Methylobacterium phyllosphaerae: MCBMB27_03078Help
Entry
MCBMB27_03078     CDS       T04968                                 

Definition
(GenBank) xylose isomerase
Organism
mphy  Methylobacterium phyllosphaerae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: APT32369
LinkDB All DBs
Position
complement(3278753..3279625)
Genome map
AA seq 290 aa AA seqDB search
MTLRFAYNTNGAANHRLDDAIHLIKAAGYDGVALTLDIHHLDPFSETWAAEAGRVASLLE
KLELTCVIETGARFLLDPTAKHEPTLVTADAAGRARRVGFLKRAIEIGGMLSAEAVSFWA
GVPKPGVDPGEARRWLAEGLHEVAAFATEAGVVPCLEPEPGMLIETLDDYASLDVPGLKL
ALDTGHCLVTGEREPAAAVREFADRIGTVAIEDMKRGSHIHLPFGEGDMDVPGVLEALEA
INFGKLICVELSRESHRADVMIPQALDYLRGCRRPGPVLAGEQETRRQWQ
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgacgctccggttcgcctacaacaccaacggcgcggccaaccaccgcctcgacgacgcg
atccacctgatcaaggccgcgggctacgacggcgtggccctgacgctggacatccaccac
ctcgatccgttctccgaaacctgggcggcggaggccggccgggtggcgagcctgctggag
aagctggagctgacctgcgtcatcgagacgggcgcccgcttcctcctcgaccccaccgcc
aagcacgagccgacgctcgtgacggccgatgccgcgggccgcgcccggcgggtcggcttc
ctcaagcgggcgatcgagatcggcggcatgctgagcgccgaggcggtctcgttctgggcc
ggcgtgccgaagcccggcgtcgatcccggcgaggcccggcgctggctggccgaggggctg
cacgaagtcgcggccttcgccacggaggcgggcgtcgtcccctgcctggagccggagccc
ggcatgctgatcgagaccctcgacgattacgcgtccctcgacgtgccggggctgaagctc
gccctcgataccggccactgcctcgtcacgggcgagcgcgagccggcggcggccgtgcgg
gaattcgccgaccggatcggcaccgtggcgatcgaggacatgaagcgcggcagccacatc
cacctgcccttcggcgagggcgacatggacgtgccgggcgtcctggaggcgctggaggcg
atcaacttcggcaagctgatctgcgtcgagctgtcccgcgagagccaccgggccgacgtg
atgatcccgcaggcgctcgactacctccgcggctgccggcgccccggcccggttctggcc
ggcgagcaggagacgcggcggcaatggcagtga

DBGET integrated database retrieval system