KEGG   Methylobacterium phyllosphaerae: MCBMB27_03673Help
Entry
MCBMB27_03673     CDS       T04968                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00010  Glycolysis / Gluconeogenesis
mphy00052  Galactose metabolism
mphy01100  Metabolic pathways
mphy01110  Biosynthesis of secondary metabolites
mphy01120  Microbial metabolism in diverse environments
mphy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCBMB27_03673
   00052 Galactose metabolism
    MCBMB27_03673
Enzymes [BR:mphy01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MCBMB27_03673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: APT32964
LinkDB All DBs
Position
3907783..3908823
Genome map
AA seq 346 aa AA seqDB search
MPAEAFGTTADGRPVTRHVLSRDGLRVAIIDFGAAVTAIEVPDRAGHSANVVLGLDTLAA
YETLSPSFGAIVGRYANRIAGGRFSLDGQSYRLPVNEAPNTLHGGPDNFGRRLWRADLSE
ATRLVLSRRSPDGEEGFPGTLDVRVTYSLPEDGVLRIDYAAVTDRPTVVNLTNHSYFNLA
GEGTGSVLGHIVQVEADAFAPTDATQIPTGALQPVAGTPFDFRTPRALKTRIREGDPQLA
YAKGYDHTFVLRGAAGTLRPAATCIAPGSGRRLDVWTTQPALQLYSGNNLDGRLIGPSGR
IYRSGDGVCFETQGFPDAPNQPAFPSAVLRPGETFAATTEFRFSVV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgccggccgaagcgttcggcaccaccgcggatggacggccggtcacccgccatgtcctg
agccgggacggtctgcgcgtcgccatcatcgatttcggcgcggccgtcacggcgatcgag
gtgcccgaccgcgccggccattcggccaacgtcgtcctcggcctcgacaccctcgcggcc
tacgagacgctgagcccgagcttcggcgccatcgtcggccgctacgccaaccgcatcgcg
ggcgggcgcttcagcctcgacgggcagagctatcgcctgcctgtgaacgaggcgcccaac
accctccacggcggcccggacaatttcggccggcgcctgtggcgggcggacctctccgag
gcgacgcgcctcgtcctgagccgccgctccccggacggggaagagggatttcccggcacc
ctcgatgtccgcgtgacgtacagccttccggaggacggcgtgctgcgcatcgattacgcc
gccgtcaccgaccggccgacggtcgtgaacctcaccaaccacagctacttcaacctcgcc
ggggaggggacgggcagcgtcctcggccacatcgtgcaggtcgaagcggacgcattcgcg
ccgacggacgcgacccagatccccaccggcgcgctccagccggtcgccgggacgccgttc
gacttccgcacgccccgggccctgaagacccggatccgcgagggggacccgcagctcgcc
tacgccaagggctacgatcacaccttcgtcctgcgcggggccgcagggacgctgcggccg
gccgccacctgcatcgcccccggcagcgggcgccggctcgacgtctggaccacgcagccg
gcgctgcagctctacagcggcaacaatctcgacgggcggctgatcgggccctccggacgc
atctaccggtccggggatggcgtctgcttcgagacgcagggctttccggacgcgccgaac
cagccggcctttccctccgcggtcctgcggccgggcgagaccttcgcggcgaccacggag
ttccggttctcggtggtgtga

DBGET integrated database retrieval system