KEGG   Methylobacterium phyllosphaerae: MCBMB27_04553Help
Entry
MCBMB27_04553     CDS       T04968                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00620  Pyruvate metabolism
mphy00680  Methane metabolism
mphy00710  Carbon fixation in photosynthetic organisms
mphy01100  Metabolic pathways
mphy01120  Microbial metabolism in diverse environments
mphy01200  Carbon metabolism
Module
mphy_M00168  CAM (Crassulacean acid metabolism), dark
mphy_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCBMB27_04553
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MCBMB27_04553
   00680 Methane metabolism
    MCBMB27_04553
Enzymes [BR:mphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MCBMB27_04553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase Transposon_TraM
Motif
Other DBs
NCBI-ProteinID: APT33844
LinkDB All DBs
Position
complement(4863071..4865950)
Genome map
AA seq 959 aa AA seqDB search
MQHEPSREPEELEAHLLGLIEAAREQAREDPFRNPVLAVTLAITRRFDRNEISAGDLDGL
FVRLRAEALAARAERLRAYVGLDASPEDPQAGIPARLVAAIPDRSDSVEAFAALIHRTAF
AVVFTAHPTFGMPRAVAGLLAEAASLPDAAARAGLIERAATLSTRPDAPITLDVEFEQAC
AAANNGRLALDAFNGALLDAARARWPDRWTELTPRPFAIASWVGCDTDGRTDIGWWDTLR
YRLISKRMQFDRVMRDLPASPACREVRALAENALAAVNRQLTVAPRLGDQPSLEAVHRFA
LALIIERERAQTDAGALVAALTKALEAADDGADRRRIAVLRAGVATHGLSNALPHFRLNA
SQIHNAVRRVIDLEGEPTDAARRRSHLATIHTLLNDVRPVAVDFGALAAERASAARLMMT
IAQILKHVDGTHPVRFLIAETETGYTLLAALWLARHYGIADKLEITPLFETASALEQGIR
VLDDALRNPHWRQYLKRIGRLTVQFGYSDSGRYVGQLAATFWIERLRLRITEMLVQNGLS
DVELAIFDTHGESIGRGAHPTSLRDRLAYLAPEDARDRARKAGIRVRLESSFQGTDGYLL
YGTEALARASVARIAEHVYALDVTEEDSFSDYALNDHPKAADAKVDPIYAEPDFALEFFT
AARQDMEALVDDPGYAALLGTFGPSLIDRTGSRPVARQTDNGGPARITHPRQMRAIPNNA
ILHQLGFLANSLHGIGRAAQRGPDLFRDMRRDSVRFSRAFRLVQHAASVGDLDVLRAYID
TLDPAVWLERARRTQKDFRRDELVVISGALERLDLAPALRNLFGRLTRDWLALRAAAPDL
PAMSARLTLLHALRLALIHRIWFLAVHIPGFRPQAGISREQLLERFLRLDIDGCLKLLDA
IFPITPDPTLGLNFGEPAGPRDVGTYEAEHANLFQPIRRMFDQVREISGMIQHEVGAFG
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgagccgagccgcgagcccgaggaactggaggcgcacctcctcggactgatt
gaggcggcccgggaacaggcccgcgaggacccgttccgcaatcccgtcctggcggtaacc
ctggcgatcacccggcggttcgacaggaacgagatctcggcaggcgacctggacggcctg
ttcgtgcgcctgcgcgccgaagccctggcggcccgggcggagcggctgcgggcctatgtc
gggctcgatgccagccccgaggatccgcaggcggggattcccgcccgtctcgtggcggca
atccccgaccggtcggacagcgtcgaggccttcgcggccctcatccaccgcaccgccttc
gcggtggtgttcaccgcccatcccaccttcggcatgccccgggcggtcgccggcctcctc
gccgaggccgcgagcctgcccgacgctgcggcccgcgccgggctgatcgaacgggcggcg
actttgtccacgcggccggacgcgccgatcaccctcgacgtcgagttcgagcaggcctgc
gcggcggccaataacgggcggctcgccctcgacgccttcaacggcgccctgctcgacgcc
gcccgcgcccgctggcccgaccgctggaccgaactgacgccccgccccttcgccatcgcc
agctgggtcggctgcgacacggacgggcggaccgacatcggatggtgggacaccctccgc
taccggctgatctcgaagcggatgcagttcgaccgggtgatgcgcgatctgcccgcgagt
cccgcgtgccgggaggtccgtgccctcgccgagaacgcgctggcagcggtgaaccgccag
ctcaccgtggcgccgcgcctcggcgaccagccgtccctcgaggcggtgcaccgcttcgcc
ctggccctcatcatcgagcgcgagcgcgcccagaccgacgcgggcgccctcgtcgccgcg
ctgaccaaggccctcgaggctgccgacgacggggccgacagacggcggatcgcggtcctg
cgcgcgggcgtcgcgacgcacggcctgtcgaacgccctgccgcatttccggctgaacgcc
agccagatccacaatgcggtacgccgggtgatcgacctcgaaggcgagcccaccgacgcg
gcccggcgccggtcgcacctcgcgacgatccacaccctgctgaacgatgtccggccggtc
gccgtcgatttcggggcgctcgcggccgagcgggcctcggccgcccggctgatgatgacg
atcgcccagatcctcaagcacgtcgacggcacccatccggtgcgcttcctcatcgccgag
accgagaccggctacaccctgctggccgccctctggctggcgcggcactacggcatcgcc
gacaagctggagatcacgccgctgttcgagacggcaagcgccctcgaacagggcattcgg
gtgctcgacgacgccctgcgcaacccccactggcgccagtatctgaagcgcatcggccgg
ctgaccgtgcagttcggctattccgattcgggccgctatgtcggccagcttgcggcgacc
ttctggatcgagcgactgcggctgcgcatcaccgagatgctggtccagaacggcctgtcc
gacgtcgagctcgcgatcttcgacacgcacggcgaatcgatcgggcgcggcgcccatccg
acctccctgcgcgaccgcctcgcctacctcgcccccgaggatgcgcgggaccgggcccgc
aaggccggcatccgggtccggctcgaatcgagcttccagggcaccgacggctacctgctg
tacggcaccgaggcgctggcccgcgccagcgtcgcccgcatcgccgagcacgtctacgcg
ctcgacgtgacggaggaggattcgttctcggactacgccctgaacgaccatcccaaggcg
gccgacgccaaggtcgatccgatctacgccgagccggatttcgccctcgaattcttcacc
gcggcccgccaggacatggaggcgctggtcgacgatccgggctacgccgccctgctcggc
accttcggcccgagcctgatcgaccggaccggctcacgtccggtggcacgccagaccgac
aatggcggcccggcgcggatcacccatccgcgccagatgcgggcgatccccaacaacgcg
atcctgcaccagctcggcttcctggcgaattccctgcacgggatcggccgggccgcccag
cgcggcccggacctgttccgcgacatgcgccgcgattcggtgcgcttctcccgggccttc
cggctggtgcagcacgccgcctcggtgggcgacctcgacgtgctgcgcgcctatatcgac
accctcgatccggccgtgtggctggagcgggcgcggcgcacgcagaaggatttccgcagg
gacgagctggtcgtgatctccggggccctggagcgcctcgatctcgcccccgcgctccgg
aacctgttcggacgcctgacccgcgactggctcgccctgcgcgcggccgccccggacctt
cccgccatgtcggcgcggctgaccctgctccacgccctgcggctcgcgctgatccaccgg
atctggttcctggcggtgcacatcccgggtttccggccccaggcgggcatctcacgcgag
cagctgctggagcgcttcctgcggctggacatcgacggctgcctgaagctcctcgacgcg
atcttcccgatcacgccggatccgacgctcggcctgaacttcggcgagccggccggcccg
cgggacgtcggcacctacgaggcggagcacgccaacctgttccagccgatccgccggatg
ttcgaccaggtccgcgagatctccgggatgatccagcacgaggtcggcgcgttcggatga

DBGET integrated database retrieval system