KEGG   Methylobacterium phyllosphaerae: MCBMB27_05133Help
Entry
MCBMB27_05133     CDS       T04968                                 

Definition
(GenBank) long-chain-aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
mphy00010  Glycolysis / Gluconeogenesis
mphy00620  Pyruvate metabolism
mphy01100  Metabolic pathways
mphy01110  Biosynthesis of secondary metabolites
mphy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mphy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MCBMB27_05133
   00620 Pyruvate metabolism
    MCBMB27_05133
Enzymes [BR:mphy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MCBMB27_05133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: APT34424
LinkDB All DBs
Position
5481809..5483332
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLGDAKVKSPFSARYENFIGGQWVAPAAGRYFENTSPITGKVVCEVARSDAQDVE
KALDAAHAAKEAWGRTAPAERARILLKMADRMEENLDLLALAETWDNGKPIRETTHADIP
LAIDHFRYFAGCVRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASVLVLAEIIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVANEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFMERAVKRVEAITQGSPLDPATMIGAQASGEQMEKILSYIDIG
KQEGAQLLTGGERNVKEGEFAEGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKDDAEA
LAIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSAKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaattcctcggcgacgccaaggtcaagtcgccgttctcggcccgctac
gagaacttcatcggcggccagtgggtcgcccccgcggccggccgctacttcgagaacacc
tccccgatcaccggaaaggtggtgtgcgaggtggcccgctccgacgcgcaggacgtcgag
aaagcgctcgacgccgcccacgccgccaaggaggcctggggccgcacggcgccggccgaa
cgcgcccgcatcctcctcaagatggccgaccggatggaggagaacctcgatctgctcgcc
ctcgccgagacctgggacaacggcaagccgatccgcgagacgacccacgccgacatcccg
ctggccatcgaccacttccgctacttcgccggctgcgtgcgggcgcaggaaggctcgatc
tccgagatcgatcacgacacggtcgcctaccatttccacgagccgctgggcgtggtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctcgccccggcgctc
gccgccggcaattgcgtggtcttgaagcccgccgagcagaccccggcctctgtgctggtg
ctggccgagatcatcggcgacctgctgccgccgggcgtgctcaacatcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcctcgccgcggatcgccaagatcgccttcacg
ggtgagacgaccaccggccgcctcatcatgcagtatgcgtcgcagaacctgatcccggtg
acgctggaactcggtggcaagtcgccgaacatcttcttcgccgacgtggcgaacgaggac
gacgacttcttcgacaaggcgctggaaggcttcacgatgttcgccctcaaccagggcgag
gtctgcacctgcccgagccgcgcgctcgtgcatgagtcgatctacgaccgcttcatggag
cgggcggtgaagcgcgtcgaggcgatcacgcagggctcgcccctcgatccggccacgatg
atcggcgcccaggcctcgggcgagcagatggagaagatcctcagctacatcgacatcggc
aagcaggagggcgcccagctgctcaccggcggcgagcgcaacgtcaaggagggcgagttc
gccgagggcttctacgtgaagccgacggtgttccgcggccacaacaagatgcggatcttc
caggaggagatcttcggcccggtactgtcggtcacgaccttcaaggacgatgccgaggcg
ctcgcgatcgccaacgacacgctctacggcctcggcgccggcgtctggacccgcgacggc
acccgcgcctatcgcttcggccgggcgatccaggccggccgcgtctggacgaactgctac
cacgcctacccggctcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgatcactaccagcagaccaagaacatgctggtcagctactcg
gccaagaagctcggtttcttctga

DBGET integrated database retrieval system