KEGG   Methanolacinia petrolearia: Mpet_2428Help
Entry
Mpet_2428         CDS       T01312                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00250  Alanine, aspartate and glutamate metabolism
mpi00410  beta-Alanine metabolism
mpi00430  Taurine and hypotaurine metabolism
mpi00650  Butanoate metabolism
mpi01100  Metabolic pathways
mpi01110  Biosynthesis of secondary metabolites
mpi01120  Microbial metabolism in diverse environments
mpi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mpet_2428
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mpet_2428
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mpet_2428
   00430 Taurine and hypotaurine metabolism
    Mpet_2428
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Mpet_2428
Enzymes [BR:mpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Mpet_2428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ADN37174
UniProt: E1RED1
LinkDB All DBs
Position
2427939..2429333
Genome map
AA seq 464 aa AA seqDB search
MGLKHPKGPKHNAKEIRIDPIFAQEGFRSIPRCSMPEKEMSPDLAYQIVHDELMLDGNAR
LNLATFVGTWMEPQAQKLASETFDKNMIDKDEYPQTAELEMRCVSILSHLWNSPDPDNST
GCSTTGSSEAAMLGGLAMKRRWQHKRKAGGKPIDNPNIVMGINVQVCWEKFANYWDVEMR
LVPMEGNRFHLSAEEAIKLCDENTIGVIAILGSTFDGSYEPVKEICGALDKFHEKTGIDI
PVHVDAASGGMIAPFLDQDLIWDFRLQRVASINTSGHKYGLVYPGVGWVVWRDAKMLPED
LIFYVNYLGSNMPTFALNFSRPGSQIILQYYNFLRLGFDGYTKVQGYAREVAMYLSKEIE
NLGPFELITRGDELPVFAFKLRDSVKNFSVFDVSNKMRERGWLIPAYTFPANRTDLAALR
IVVRRGLSQDLADLFLDDLKRQLPILQSQPEPVHDEKSGSGFHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgggactaaaacatccgaaaggacctaaacataatgcaaaagagataagaattgatccg
attttcgcacaggaaggcttcaggagtattcccaggtgctcaatgcccgaaaaggagatg
agcccggacctggcctatcagattgttcacgacgaactgatgctggacggaaatgcaagg
ctgaacctcgctacatttgtcggcacatggatggagccccaggcgcagaaactcgcgtcc
gagacattcgacaagaacatgatcgacaaggacgaatacccgcagaccgccgaacttgag
atgcggtgcgtaagtatcctcagccacctctggaattcaccagatcccgacaattcgacc
gggtgctcgactacaggatcgagcgaggcggcaatgctcgggggccttgcgatgaagagg
agatggcagcacaagagaaaggccggaggaaaacctatcgacaatccgaacatcgttatg
gggatcaatgtgcaggtctgctgggagaagttcgcgaactactgggacgtcgagatgcgt
ctcgtcccgatggaaggaaaccgcttccacctctccgccgaggaggccataaaactctgc
gatgaaaataccataggggtcattgcaatacttggttccacatttgacggatcatacgag
ccggtaaaggagatctgcggcgcactggacaagttccatgagaaaacagggatcgacatc
cccgtccatgtggatgcagcctccggcgggatgatcgcgcccttcctcgaccaggacctg
atatgggacttccgcctccagagagttgcatcgatcaacacatccgggcacaagtacggg
ctcgtatacccgggtgtggggtgggttgtctggagagacgcaaagatgctccccgaagac
ctgatattctacgtcaactatctgggatcgaacatgccaacattcgctctcaacttctca
agacccggttcccagatcatactccagtactacaacttcctccgcctcggctttgacggg
tatacgaaggtacagggttatgcacgcgaggtagcaatgtacctctcgaaagagatcgaa
aatctcggaccgttcgaacttattacaagaggcgatgaactacccgtcttcgcgttcaaa
ctcagggacagcgtgaaaaatttctctgtattcgacgtatcgaacaagatgcgggaacgc
gggtggctcattcctgcgtacacgttcccggctaacaggaccgatctcgcagcactccgc
atagtggtaaggagaggcctctcacaagacctggcagacctcttcctcgacgatttaaag
cgccagcttccgatacttcagagccagccggaaccggttcacgacgagaagtcggggtcc
ggattccatcactga

DBGET integrated database retrieval system