KEGG   Methanolacinia petrolearia: Mpet_2629Help
Entry
Mpet_2629         CDS       T01312                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mpi  Methanolacinia petrolearia
Brite
KEGG Orthology (KO) [BR:mpi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mpet_2629
Enzymes [BR:mpi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mpet_2629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox GIDA HI0933_like Thioredoxin_3 Thi4 FAD_binding_2 FAD_oxidored NAD_binding_8 GST_N_3 K_oxygenase NAD_binding_9 Lycopene_cycl Trp_halogenase NAD_binding_7 FMO-like AlaDh_PNT_C DAO FAD_binding_3 SH3BGR GST_N_2
Motif
Other DBs
NCBI-ProteinID: ADN37372
UniProt: E1RFR8
LinkDB All DBs
Position
2640122..2641291
Genome map
AA seq 389 aa AA seqDB search
MEKAVTMPDVKVYSTKQCQYCRLLKAFLDKKGIKYQNIDVGEDIEAAKEMVELSGQYAVP
VTVIDGEVIVGYDVRRLNELFGDTGEKGEIDIIILGGGPAGLTAAAYAARKLLRCMIITE
DIGGQALESWAIENYMGFRIISGSDLMQKFEEQVRNEDIEIEIDRAESIEESNGKFVITT
VSGQKFEGKSVIIATGVKPRWLGIKDEEKYIGHGISICSTCDGPLFRDKIVTIVGGGNYA
VTTAIEMSKLATHVNLIVRSKIRADEVYTSQYEGLENVSTYKNYTVSALEGDNMLKAVTI
KERDTGEESKLETDGLFLAIGHDANTGFLEGFVDLNENGEIITDNNGRTSHNGVFAAGDV
TDTKSKQVIIASGEGAKAALSAYSFLVNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagttactatgccggatgtaaaagtttactcgacaaaacagtgccagtac
tgcagactgctcaaggcgtttcttgacaaaaaaggaataaaatatcaaaatattgatgtg
ggagaagatattgaagcagccaaagagatggttgaactctcgggccagtatgcagtacct
gtaactgtaatcgacggcgaggtcatcgtaggctatgacgtcaggagactgaacgaactt
ttcggggataccggagaaaaaggtgaaatcgacattattattcttggcggaggacctgca
gggcttacagcagctgcatatgcagcgagaaagctgctcagatgcatgataattacagag
gacataggcggacaggccctggaatcctgggcaattgaaaactatatgggattccgtata
atatccggaagcgatctcatgcagaaatttgaagagcaggtcaggaatgaggatattgag
atcgagatagaccgggccgaatcgattgaggagagtaacggaaaattcgtcatcactacg
gtatcagggcagaaatttgaaggtaaatcggtgattattgcaacaggtgtcaaacccagg
tggcttggaataaaagatgaagaaaaatatatcggccacgggatcagcatatgctccaca
tgcgacggtccgctcttccgcgataaaattgtgacaattgtcggaggaggaaattacgca
gtcacgacagccattgaaatgagcaaacttgccacacacgtaaaccttatagtaagaagc
aaaatcagggctgacgaggtatacaccagccagtacgaggggcttgagaatgtttcaact
tataaaaactacactgtaagcgcccttgagggggacaatatgctcaaagcagttacaatt
aaagaaagagacactggcgaagagtcaaaacttgaaacagacggtctcttcctcgctatc
ggccatgatgcaaataccggattccttgaaggcttcgtcgatctcaatgaaaacggagag
atcatcacagacaacaacggcaggacatcacataatggcgtctttgcagccggcgatgtt
accgataccaagagcaagcaggtaattattgcctcgggagaaggtgcaaaagccgcactt
tccgcctattctttccttgttaacaaataa

DBGET integrated database retrieval system