KEGG   Microcystis panniformis: VL20_3426Help
Entry
VL20_3426         CDS       T04037                                 

Definition
(GenBank) Ribulose bisphosphate carboxylase small chain
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mpk  Microcystis panniformis
Pathway
mpk00630  Glyoxylate and dicarboxylate metabolism
mpk00710  Carbon fixation in photosynthetic organisms
mpk01100  Metabolic pathways
mpk01120  Microbial metabolism in diverse environments
mpk01200  Carbon metabolism
Module
mpk_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mpk_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mpk_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VL20_3426
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VL20_3426
Enzymes [BR:mpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VL20_3426
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AKV68433
UniProt: A0A0K1S352
LinkDB All DBs
Position
complement(2927858..2928193)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKEKRYETLSYLPPLTDQQIAKQIQYMIDQGYIPAVEFEKDPKPADYHWTMWKLPL
FSVSGPQEVLNEVRECRTEYSDCYIRVIAFDNIKQCQTMSFIVHKPNAGRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacctaaagagaagcgttacgaaactctttcctacttgccccccctcacc
gatcaacaaattgctaaacaaattcaatacatgatcgatcagggttatattcctgctgtg
gaatttgaaaaagatcccaaacccgcagattatcattggacgatgtggaaactgccttta
ttctctgtttctggcccccaagaagttcttaatgaagttcgcgagtgccgcaccgagtat
tctgattgctatatccgcgttatcgcttttgacaacatcaaacaatgtcaaaccatgagc
tttattgttcataaacccaatgccggccgctactaa

DBGET integrated database retrieval system