KEGG   Microcystis panniformis: VL20_3662Help
Entry
VL20_3662         CDS       T04037                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mpk  Microcystis panniformis
Pathway
mpk00250  Alanine, aspartate and glutamate metabolism
mpk00410  beta-Alanine metabolism
mpk00430  Taurine and hypotaurine metabolism
mpk00650  Butanoate metabolism
mpk01100  Metabolic pathways
mpk01110  Biosynthesis of secondary metabolites
mpk01120  Microbial metabolism in diverse environments
mpk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    VL20_3662
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VL20_3662
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VL20_3662
   00430 Taurine and hypotaurine metabolism
    VL20_3662
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VL20_3662
Enzymes [BR:mpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     VL20_3662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AKV68652
UniProt: A0A0K1S3E1
LinkDB All DBs
Position
complement(3124904..3126307)
Genome map
AA seq 467 aa AA seqDB search
MVHQKINLDRLSPEEALITPTYASRALTSAVPKYEIPEGEMPPAVAYNLIRDELALDGNS
RLNLATFVTTWMEPEAKQLMAETFDKNMIDKDEYPQTAEIELRCVNMIARLWNAPESEAA
TGCSTIGSSEAAMLGGMALKWQWRKRRQKEGKPTDKPNLVMGINVQVCWEKFSRYWEVEP
RFVPMEGSRFHLNATEAIKLIDENTIGVIAIMGSTFDGSYEPVQEINDALEKLNRETGWQ
VPLHVDGASGGFIAPFLDPDLVWDFRLKWVKSINASGHKYGLVYPGVGWIIWRDRQELPE
ELIFHCNYLGGDLPNFALNFSRPGNQVVAQYYNFLRLGKEGYRQIHQACRDTALYLSGEI
AKMGPFELITDGSTIPVFAWKLKETISDQSNYSLFDLADKLRERGWLVPAYTMPKNRQDL
TVQRVVIKEGFSRDMAALLLRDIHSAIAFFQSQSNYQSKLSGSHFHH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggttcatcagaaaattaatctcgatcgcctcagtccggaagaagcactaattaccccc
acctatgcttcccgcgccctgacttccgctgtacctaaatacgagattcccgagggagaa
atgccgccggcggtggcctacaatttaatccgcgatgaactcgcccttgatggtaattct
cgcctgaatctggctacttttgtcaccacttggatggaaccggaagccaaacaattaatg
gcggaaaccttcgataaaaacatgattgacaaggatgaatacccacaaaccgccgaaatt
gaactgcgttgtgtgaatatgatcgctagactctggaatgctcccgaaagcgaagctgca
accggttgttctaccattggttccagtgaagcggcgatgttgggaggcatggctttaaaa
tggcaatggcgcaaacgccgacaaaaagagggtaaacccaccgacaaacctaatttagtc
atgggcattaatgtgcaggtttgttgggaaaaattctctcgttattgggaggtagaaccg
cgttttgtgccgatggaagggagtcgttttcatctcaatgcgaccgaggcaattaaacta
attgatgagaatacgatcggggtaattgcaattatgggtagtacctttgatggtagttac
gaacccgtccaagaaattaatgatgccctggaaaaattgaacagagaaaccggctggcaa
gttcccctgcacgtcgatggtgctagtggtggttttattgccccttttctcgatcccgat
ttagtctgggattttcgcctcaaatgggttaaatcgattaatgcttccgggcataaatac
ggtttagtctatcccggtgtcggttggattatctggcgagatcggcaagaattaccagaa
gaattaatctttcattgtaattatttaggcggtgatctgcctaattttgctctgaatttt
tctcgccctggtaatcaagtagtcgctcaatattataattttttacgcttgggtaaagag
ggttatcgacaaattcatcaagcctgtagagatacggccctgtatttatcgggggaaatc
gctaagatgggaccgtttgaattgattaccgatggcagcactattccagtttttgcttgg
aaattaaaggagacaattagcgatcaatctaattatagtttattcgatttagctgataaa
ttgcgcgagcggggttggttagttcctgcctatacaatgcccaaaaatcgccaagattta
accgtgcagcgcgtggtgatcaaggagggatttagtcgtgatatggcggctctgttgttg
cgggatattcactcagcgatcgccttttttcaatctcagtctaattatcagtcaaaatta
tctggttcccattttcatcactaa

DBGET integrated database retrieval system