KEGG   Microcystis panniformis: VL20_4032Help
Entry
VL20_4032         CDS       T04037                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mpk  Microcystis panniformis
Pathway
mpk00473  D-Alanine metabolism
mpk00550  Peptidoglycan biosynthesis
mpk01100  Metabolic pathways
mpk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    VL20_4032
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    VL20_4032
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    VL20_4032
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mpk01011]
    VL20_4032
Enzymes [BR:mpk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     VL20_4032
Peptidoglycan biosynthesis and degradation proteins [BR:mpk01011]
 Precursor biosynthesis
  Amino acid ligase
   VL20_4032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AKV68980
UniProt: A0A0K1S4J8
LinkDB All DBs
Position
complement(3448613..3449671)
Genome map
AA seq 352 aa AA seqDB search
MDKIKVGLLFGGRSGEHEVSINSARSILQAFNYPENLDKYAVIPFYIDKNGCWHSAATAR
QILTSGQPLAIEREIKVNIWQFPTEVSEIEVWFPILHGPNGEDGTLQGLLTLMRVAFVGS
GVLGSCLGMDKIAMKTAFAAAGLPQVKYKAITRSQVWSNACVFPQLCDQIAEEIGYPCFI
KPANLGSSVGISKARNLQELEAALDSAASYDRRIIVEAGVTAREIECAVLGNDNPQASLV
GEITFDSDFYDYETKYTDGRSSMVIPANIPDKIANQVREMAVEAFKAVDAAGLSRVDFFY
VEKTGEVLINEINTLPGFTNFSMYPQLWKATSLEFDKLVDKLVQLALERQEK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggataagatcaaggtaggattgttgtttggtggtcgatcgggagaacatgaggtatct
atcaattcggctcgatcgatcctgcaagcttttaattaccccgaaaatcttgacaaatac
gccgttatccccttctatatcgataaaaatggctgttggcattcggcagcaactgctaga
caaattttaacctctgggcaacccctagctattgagagggagataaaagtcaatatctgg
caatttcccacagaagtgagcgaaattgaggtttggtttccaattctccacggaccgaat
ggggaagatggcactttacaaggattactcactctcatgcgggttgcttttgtgggtagt
ggggtcctgggttcatgcttgggaatggataaaattgccatgaaaactgcttttgcagcc
gctggattaccccaagttaagtataaggccataacccgctcgcaagtgtggtcaaatgcc
tgtgtttttccgcaattgtgcgatcaaatcgccgaggaaataggttatccttgttttatt
aaaccggctaatttaggttcttcggtgggtattagtaaagcacgcaacctgcaagaatta
gaggctgctttagatagtgccgctagttatgatcgacggattattgttgaagcaggagta
accgcaagggagatcgaatgtgcggttttaggtaatgataatccccaagcttctttggtg
ggagaaattacttttgatagtgatttttatgactatgaaactaaatatactgacgggcga
tcgagcatggtgattcccgctaatattcctgataaaattgctaatcaagtgcgagaaatg
gctgtagaagcatttaaagctgtggatgctgcgggattgtcgcgggtggattttttctat
gtggaaaagactggggaagtgttgatcaatgaaattaatactctgccggggtttactaat
tttagtatgtatccccaactctggaaagccaccagtttagagtttgataaattggtcgat
aagttagtacaattagccttagaaagacaggaaaaataa

DBGET integrated database retrieval system