KEGG   Microcystis panniformis: VL20_5480Help
Entry
VL20_5480         CDS       T04037                                 

Definition
(GenBank) leucine-rich-repeat protein
  KO
K06883  uncharacterized protein
Organism
mpk  Microcystis panniformis
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    VL20_5480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: COR LRR_4 LRR_8 Roc LRR_9 Ras LRR_5 Arf Beta_helix Gtr1_RagA NosD MMR_HSR1 DUF2207
Motif
Other DBs
NCBI-ProteinID: AKV70308
UniProt: A0A0K1S8F2
LinkDB All DBs
Position
complement(4775226..4777991)
Genome map
AA seq 921 aa AA seqDB search
MTAREVLELIQQAKDERAGELALSGRNLTEIPPEIPQLTSLQYLNLRNNQISEIPEALAQ
LTSLQHLRLSNNQISEIPEALAYLTSLRFLLLSDNQIREIPEALAQLTSLQVLNLSDNQI
REIPEALAQLTSLQVLNLSNNQIREIPEALAQLTSLQSLHLSNNQIREIPKALAQLTSLQ
DLDLRNNQIREIPKALAQLTSLQHLFLYNNQIREIPEALAQLTSLQDLDLRNNQIREIPE
ALAQLTSLQDLDLRNNQIREIPEALAHLVNLKRLVLENNPITNVPPEIIRQGWGETILDD
GNPQAIFNYLKDKGKKRPLNELKVLLVGEGDVGKTSLLKRLLHNTFNSGEPKTPGINIER
WPLPQKPDIRLNIWDFGGQKVMQTTHQFFLTKRSLYLLVLDNRKNEQQNRLEYWLKLIET
YGGNSPVIIVGNCADENPPQVKIRTLRKKYPQITKLIATSCKTGVGIEQLVQEIASQIDA
IPHIKDLLPNSWFQIKTQLETMQESYDFISYEKYQEMCQTAEIKEASDQKSLVQFLHDLG
IVLNYQDDPRLNETNVLNPEWVTDGVYDILNNHDLMVQKKGILSLPDLQDILKQPQRYPE
NKRGFLMDLMGKFELCFPLDGYSPARYLITDLLPIDEPDVDSYENAPLHFQYRYDILPGS
IISRFIVRNHQMIYKTMRWRSGVVLTMDLNKALVRADEEDNYISIKAQGSRANALLAIIK
TDFQKIHATIPNLAVQEKLVIRELQGEKPTGVEVPVDYLHLIELDRQGSVEATLPGLRGK
YNIRDILEGVESKRERERHLDEREERSRKSRENRPMSPKTPETPNLLKPSLALLLVLAVV
TFIFAVLANTVPVVQFITSVLTIIFIFALIVIVLLFWTGKINETTFNQFLEGFWRSITIF
KGQEPKTNNDDTPQETPESEQ
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacgggaagtattagagttaattcaacaggcaaaggacgaaagagcgggggag
ttggctctgtctggcagaaacttaacagaaattccccccgaaatccctcaactcacctcc
ctgcaatacctcaacctcagaaataaccaaatcagcgagattccagaagcgctcgctcaa
ctcacctccctgcagcacctccgtctcagcaataaccaaatcagcgagattccagaagca
ctcgcttacctcacctccctgcgattcctcctcctcagcgataaccaaatcagggagata
ccagaagcgctcgctcaactcacctccctgcaagtcctcaacctcagcgataaccaaatc
agggagataccagaagcgctcgctcaactcacctccctgcaagtcctcaacctcagcaat
aaccaaatcagggagataccagaagcgctcgctcaactcacctccctgcaaagcctccac
ctcagcaataaccaaatcagggagataccaaaagcgctcgctcaactcacctccctgcaa
gacctcgacctcagaaataaccaaatcagggagataccaaaagcgctcgctcaactcacc
tccctgcagcacctctttctctacaataaccaaatcagggagataccagaagcgctcgct
caactcacctccctgcaagacctcgacctcagaaataaccaaatcagggagataccagaa
gcgctcgctcaactcacctccctgcaagacctcgacctcagaaataaccaaatcagggag
attccagaagcgctcgctcacctagtcaacctgaagcgattagtcctcgaaaataacccg
attaccaacgttcccccggaaattattcgtcagggatggggtgaaacaatattggatgat
ggcaacccgcaggcgatttttaattatctcaaggataaagggaaaaaacgccctcttaat
gagcttaaagttttattggtgggggagggggatgtggggaaaacttccctgttaaagcgg
ttactgcacaatacctttaattccggagaacccaagacccccggcattaatattgaaagg
tggccactgccccaaaaacccgatattcgcctcaatatctgggattttggcggtcagaaa
gtgatgcaaaccacccatcagttttttctgactaaacgcagtctttatctgcttgtcctc
gacaaccgcaaaaatgaacagcaaaaccgtctggaatactggttaaaactcattgaaacc
tacggaggcaattctcccgtgattatcgtgggtaattgtgccgatgaaaatcccccccaa
gttaagatccgcaccctccggaaaaaatatccccaaatcaccaagctaatcgccacttcc
tgtaaaaccggtgtgggaatcgagcaacttgtgcaggaaatcgcctcccaaatcgatgct
attccccatatcaaagatttattgcctaatagttggtttcagatcaaaactcaactagaa
acgatgcaagagagttatgactttatttcctacgaaaagtatcaggaaatgtgtcagaca
gccgagattaaagaggccagcgatcaaaaaagtttagtgcagtttctccacgatctcggt
attgtcctcaactaccaagatgatccgcgactgaatgaaaccaatgtcctgaacccggaa
tgggtaactgacggtgtttatgatattctcaataatcacgatttgatggtgcaaaaaaag
ggcattctttcactgccagatctgcaagatattctcaaacaaccccaacgttatcccgaa
aataaacgcggatttttgatggatttgatgggaaaatttgaactctgttttccccttgat
ggttacagtcccgctcgctatctaatcaccgatcttctacccatcgatgaaccggatgtg
gatagctacgaaaacgcacctttacacttccagtaccgttatgatatcctgcccggtagc
attatttcccgctttatcgtccgtaatcaccagatgatctataaaaccatgcgttggcgt
agtggtgtggttctgacaatggatcttaataaagctttggtgcgtgccgacgaggaagat
aactacatcagcataaaagcccagggttcccgtgctaatgcgcttttagctattattaag
acagattttcagaaaattcacgctactatccctaatttagccgtacaggaaaagttagtg
attcgagaattgcaaggggaaaaacccaccggggtagaagttcccgtcgattatctccat
ctgatagaactcgatcgccaaggcagcgtggaagcaactctccccggtttgcgcggcaaa
tacaatatccgcgatatcttagaaggggtggaatctaagagagaaagagaaagacatctc
gacgaaagggaggaacgtagccgcaaaagccgagaaaatcgccctatgagtcccaaaacg
ccagaaactcccaatctcctgaaacctagtctcgctttgttgctggttttagctgtggtt
acttttatctttgcggtgcttgccaatactgtgccagtggtacagtttattaccagcgtt
ttgacaattatttttatctttgctcttattgtgattgtgttattgttctggacgggtaaa
atcaatgaaacgacctttaatcagtttttagagggtttttggcgatctatcacgattttt
aaaggacaagaaccaaaaaccaacaacgatgacaccccccaagaaacccccgaatcggag
cagtaa

DBGET integrated database retrieval system