KEGG   Microcystis panniformis: VL20_732Help
Entry
VL20_732          CDS       T04037                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpk  Microcystis panniformis
Pathway
mpk00010  Glycolysis / Gluconeogenesis
mpk00020  Citrate cycle (TCA cycle)
mpk00620  Pyruvate metabolism
mpk01100  Metabolic pathways
mpk01110  Biosynthesis of secondary metabolites
mpk01120  Microbial metabolism in diverse environments
mpk01130  Biosynthesis of antibiotics
mpk01200  Carbon metabolism
Module
mpk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VL20_732
   00020 Citrate cycle (TCA cycle)
    VL20_732
   00620 Pyruvate metabolism
    VL20_732
Enzymes [BR:mpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VL20_732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AKV65941
UniProt: A0A0K1RW52
LinkDB All DBs
Position
complement(618467..619708)
Genome map
AA seq 413 aa AA seqDB search
MPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVILVEAGQE
APVGEAIAYIAETEAEIELAKAQGKTATAAPSKPVETPEIAPPPVSIPVAAVKDNGRLVA
SPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVSVPVAAP
KAPIPTSAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQLKSKGVT
MTALLAKAVANTLAKHPIVNASYSDAGIQYHGAINVAVAVAMPGGGLITPVLRSADQMDI
YSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAILAVGASR
PQIVVNKDGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgctcagttccaccatgaccgaaggaaaaatagtttcttgggtgaagtccccc
ggggaaaaagtcagcaaaggggaaacggtgttagtggtcgaatccgacaaagccgacatg
gacgtggaatcgttttatgatggctatctcgctgtaattttagtcgaagccggccaggaa
gcacccgtgggggaagcgatcgcctatattgccgaaactgaagcggaaattgaactggcc
aaagctcagggaaaaaccgccacagctgcccctagcaagcccgtagagaccccagaaatc
gctccgcctcccgtttcgatccccgtcgccgccgttaaagataatggccgtttagtcgct
tctcccagggccaaaaaactggctaaagaattaaaggtagatctgaaaaccctagtgggt
agcggtccccacggacgaattaccgccgaagacgtagaaaaagcgacaggaaaagtcagc
accgcccccgctcccgtcattactccgccgcaacccgtcagcgtgcctgtagcggctcct
aaagccccgattccaaccagcgccccggtcggtcggactgttcccctcaccactctgcaa
aaagccgtcgctcagaatatgtcggttagcctacaggttcccaccttccaagtgggctac
actatcaccactgacccactggatcaactctatcaacagctaaaatctaagggtgtcacc
atgacggccctcttagcaaaagcggtagctaataccctcgctaaacatcctatagttaat
gccagctatagcgacgcaggaatccaataccacggggcgattaacgtggccgtagctgtg
gctatgcctggtggtggcttaattacgccggttttgcgctctgctgaccagatggatatc
tattccctctcccgcagttggaaagatttagttgatcgcgcccgcagtaaacaactgcaa
ccggaagaatataatagcggtacttttaccatttctaatctgggaatgttcggagtcgat
cgctttaccgctatcttaccccccaaccaaggtgcaatcctggccgtgggtgcttcccgt
ccccaaatcgtcgtcaataaagatggtttattcggagtgcaaaaacagatgacggttaat
ctcaccagtgaccaccgagtcatctacggggccgatgctgcctcctttctgcaagacttg
gctaaactgatcgaaaccgaggtgcagtctttaactatgtaa

DBGET integrated database retrieval system