KEGG   Microcystis panniformis: VL20_732
Entry
VL20_732          CDS       T04037                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mpk  Microcystis panniformis
Pathway
mpk00010  Glycolysis / Gluconeogenesis
mpk00020  Citrate cycle (TCA cycle)
mpk00620  Pyruvate metabolism
mpk01100  Metabolic pathways
mpk01110  Biosynthesis of secondary metabolites
mpk01120  Microbial metabolism in diverse environments
mpk01200  Carbon metabolism
Module
mpk_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VL20_732
   00020 Citrate cycle (TCA cycle)
    VL20_732
   00620 Pyruvate metabolism
    VL20_732
Enzymes [BR:mpk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VL20_732
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: AKV65941
UniProt: A0A0K1RW52
LinkDB
Position
complement(618467..619708)
AA seq 413 aa
MPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVILVEAGQE
APVGEAIAYIAETEAEIELAKAQGKTATAAPSKPVETPEIAPPPVSIPVAAVKDNGRLVA
SPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVSVPVAAP
KAPIPTSAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQLKSKGVT
MTALLAKAVANTLAKHPIVNASYSDAGIQYHGAINVAVAVAMPGGGLITPVLRSADQMDI
YSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAILAVGASR
PQIVVNKDGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcccgcgctcagttccaccatgaccgaaggaaaaatagtttcttgggtgaagtccccc
ggggaaaaagtcagcaaaggggaaacggtgttagtggtcgaatccgacaaagccgacatg
gacgtggaatcgttttatgatggctatctcgctgtaattttagtcgaagccggccaggaa
gcacccgtgggggaagcgatcgcctatattgccgaaactgaagcggaaattgaactggcc
aaagctcagggaaaaaccgccacagctgcccctagcaagcccgtagagaccccagaaatc
gctccgcctcccgtttcgatccccgtcgccgccgttaaagataatggccgtttagtcgct
tctcccagggccaaaaaactggctaaagaattaaaggtagatctgaaaaccctagtgggt
agcggtccccacggacgaattaccgccgaagacgtagaaaaagcgacaggaaaagtcagc
accgcccccgctcccgtcattactccgccgcaacccgtcagcgtgcctgtagcggctcct
aaagccccgattccaaccagcgccccggtcggtcggactgttcccctcaccactctgcaa
aaagccgtcgctcagaatatgtcggttagcctacaggttcccaccttccaagtgggctac
actatcaccactgacccactggatcaactctatcaacagctaaaatctaagggtgtcacc
atgacggccctcttagcaaaagcggtagctaataccctcgctaaacatcctatagttaat
gccagctatagcgacgcaggaatccaataccacggggcgattaacgtggccgtagctgtg
gctatgcctggtggtggcttaattacgccggttttgcgctctgctgaccagatggatatc
tattccctctcccgcagttggaaagatttagttgatcgcgcccgcagtaaacaactgcaa
ccggaagaatataatagcggtacttttaccatttctaatctgggaatgttcggagtcgat
cgctttaccgctatcttaccccccaaccaaggtgcaatcctggccgtgggtgcttcccgt
ccccaaatcgtcgtcaataaagatggtttattcggagtgcaaaaacagatgacggttaat
ctcaccagtgaccaccgagtcatctacggggccgatgctgcctcctttctgcaagacttg
gctaaactgatcgaaaccgaggtgcagtctttaactatgtaa

DBGET integrated database retrieval system