KEGG   Methanosphaerula palustris: Mpal_0406Help
Entry
Mpal_0406         CDS       T00823                                 

Definition
(GenBank) glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mpl  Methanosphaerula palustris
Brite
KEGG Orthology (KO) [BR:mpl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mpal_0406
Enzymes [BR:mpl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mpal_0406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin GIDA Pyr_redox Lycopene_cycl GST_N_3 FAD_oxidored HI0933_like Thi4 FAD_binding_2 Thioredoxin_3 GST_N_2 FAD_binding_3 FMO-like NAD_binding_9 NAD_binding_8 NAD_binding_7 DAO DUF836 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ACL15780
UniProt: B8GJX6
LinkDB All DBs
Position
complement(424203..425354)
Genome map
AA seq 383 aa AA seqDB search
MGTVRVYFTDNCPYCKMVKAFLDKKHVAYQAINVGQDREAAAEMVKISGQYGVPVLTVDD
KVVIGFDTPRLEELFGAEKRADAVDVLIIGAGPAGLTAGVYCARKLLSTVLITENIGGQA
MESWAIENYMGYRMISGNDLMQKFEEQVRQQSLRLDLDRVETLVSEGDHFLATTATGGTI
QAKAVIVASGMHPRPLGVEGEDRYLGRGLSVCTTCDGPLFKDKKIAIVGGGNAAVQTAIE
MSRIASSVSLIVRADLKADPTYIKKLETISNITVHLYHQITQLHGDLFLDQITITDSKTG
KETTILLDGVFAEIGWLPNTGFLSDLLTLTGDGKIVVDENCHTNRAGVFAAGDVTSIKGN
QIIIAAGEGAKAALEAYRYLTRL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgtcagggtctatttcaccgacaactgtccgtactgcaagatggtcaaggct
ttcctcgataagaagcatgtcgcgtatcaggccatcaatgtagggcaggacagggaagct
gccgcagagatggtgaagatctcagggcaatacggggtacccgtgctgaccgtcgacgat
aaggttgtgatcgggtttgacaccccgcggttggaggaactcttcggcgccgagaagagg
gctgacgccgtcgatgtgttgatcatcggtgccggcccggccgggctgaccgccggtgtc
tactgcgcacgaaagttgctctcgacggtgctgatcaccgagaacatcggcggtcaggcg
atggagagctgggcgatcgagaactacatgggctaccggatgatatcaggcaacgacctg
atgcagaagttcgaggagcaggtgcggcagcagtcactccgtcttgacctggacagggtc
gagacgctcgtttcagaaggagatcacttcctggccacgaccgcgaccggcgggaccatt
caggcgaaggctgtgatcgtcgcctcaggtatgcatccacgtccgctcggggtcgagggg
gaggaccggtacctcgggcgcgggctctcggtctgcaccacctgtgacggcccgctcttc
aaggacaagaagatcgctatcgtcggcggcggcaatgcggcggtccagaccgccatcgag
atgagcaggatcgcatcgtcggtcagtctgatcgtccgagccgatttgaaggctgacccg
acctatatcaagaaactcgagactatctcgaacatcacggtccatctgtatcaccagatc
acgcagttacacggtgatctcttcctcgatcagatcacgatcactgacagtaaaaccggg
aaggagaccaccatcctgctggacggggtctttgccgagatcggctggctcccgaatacc
gggttcctcagcgatctgctgaccctgaccggtgacggaaagatcgtcgtcgatgagaac
tgtcacaccaaccgtgcaggggtctttgccgcaggagatgtgaccagtatcaagggaaat
cagatcatcatcgcggccggagaaggggcgaaagcagcgctcgaggcctaccgatacctg
acccgactctga

DBGET integrated database retrieval system