KEGG   Methanosphaerula palustris: Mpal_1563Help
Entry
Mpal_1563         CDS       T00823                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mpl  Methanosphaerula palustris
Pathway
mpl00030  Pentose phosphate pathway
mpl01100  Metabolic pathways
mpl01120  Microbial metabolism in diverse environments
mpl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mpal_1563
Enzymes [BR:mpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Mpal_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: ACL16876
UniProt: B8GIR3
LinkDB All DBs
Position
1610736..1612520
Genome map
AA seq 594 aa AA seqDB search
MDGYAGTILHVDLTRGTLASRPYPEDLQRQYFGSRGLGVRLVSDLVNPTTAPLGEGNVIV
FATGPLTGSGVPLGARYGVITKSPLNGTLCSSDSGGFFGTELKRAGFDAVVISGRSPTPV
YLWLHDTVAELKEASAYWGKTVNETTDGLLTELGDTHARVSCIGPAGERLSLIACVMNDR
YRAAGRGGPGAVMGSKYLKAIVARGSGKITTARPEELKGVTADIRARIHAGGVTGKGLPE
YGTSVLVNIINNSHMLPVRNHQAAYFPTAENLSGERVRETIFVRKKPCYACIIGCGRGTV
VDGVEAEGPEYEQTWSLGVDCGIDDLTWVARANNLCNNLGIDALSAGVTIACAMELSKKG
IIPESIRFGDREQMYDLVRQMGYREGIGDQLADGSYRFAERYGHPELSMSAKKLELAAYD
PRAVQGQGLSYATGVRGGDHINGYMISPEILGIPKRLDPFETEGKAAWTRTFQDMTAAID
ASGICLFTSLAPLGAADYAAMLSGVTGMTVTADQFMEVGERIWNLQKLFNIRAGLTKADD
TLPPRLLHEPLQEGAPKGKVWEREPMLDQYYAVRGWDAEGRPTPQTLHRLGLSG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggatggatatgccggcaccatactgcatgtcgacctgaccagaggtacccttgcatca
cggccatacccggaggatctgcagaggcagtacttcgggagccggggacttggagtcaga
ctggtgagcgacctggtcaacccgaccacggccccgctcggggaaggaaacgtgatcgtc
tttgccacgggtccgctgaccgggtcgggggttccactcggggccaggtacggggtgatc
accaaatcccccctgaacggcacactctgctcctctgacagcggcggattcttcgggacc
gaactgaaacgtgcagggttcgacgcagtcgttatatcaggccggtccccgacccctgtc
tatctgtggctgcatgatacggttgccgaactgaaggaagcctcggcctactggggaaag
accgtcaacgagaccaccgacgggcttcttacggagctcggagacacccatgccagggtc
tcctgtattggtccggccggagaacgattgagtctgatcgcctgtgtgatgaacgacagg
tatcgggccgccggcaggggcggacccggggcggtgatggggtccaagtacctcaaagcc
atcgtggccagggggtccgggaagatcaccacagcccgtccagaggagttgaagggggtg
accgccgatatcagggccaggatccatgccggcggcgtgaccgggaaggggctgcccgaa
tacggcacctcggtgctggtgaacatcatcaacaacagtcacatgctcccggtcagaaat
caccaagcggcatacttcccgactgcagagaacctctccggggagcgtgtcagggagacg
atcttcgtccggaagaaaccctgttatgcctgcatcatcggctgcgggcgggggacggtc
gtggacggtgtcgaagcagaggggccggagtacgaacagacatggtcgctcggtgtggac
tgtggtatcgacgacctgacctgggtggccagggccaacaacctctgcaacaacctcggg
atcgacgccctctctgccggggtcacgatcgcctgcgcgatggaactctccaaaaagggg
atcatcccggaatcgatccggttcggggacagggagcagatgtacgacctggtcaggcag
atgggataccgcgaagggatcggcgaccagctggccgatgggtcgtaccgttttgccgag
cggtacggtcatcccgaactctcgatgagtgccaagaaactcgaactggccgcctatgac
ccccgggccgtccaggggcagggcctctcctatgcgaccggtgtccggggcggggaccat
atcaatggatatatgatctcccccgagatactcgggatccccaagcggctcgatcccttt
gagacagaggggaaggccgcctggaccaggacgttccaggacatgaccgctgcgatcgat
gcaagcgggatctgcctcttcacctcgctggcgccgctcggggccgcggattatgccgcg
atgctctccggggtgaccggtatgacggtcaccgccgaccagttcatggaggtcggcgag
cggatctggaatctgcagaaactcttcaacatcagggccggcctgacgaaggctgacgat
acgctcccaccgcggctgctgcatgagcccctgcaggaaggggcaccgaaggggaaggtc
tgggaacgggagccgatgctcgatcagtattacgcagtccgggggtgggacgccgaaggg
cgaccgaccccacagactctacatcggctcgggctctcaggatga

DBGET integrated database retrieval system