KEGG   Candidatus Methanosphaerula palustris: Mpal_1867Help
Entry
Mpal_1867         CDS       T00823                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
mpl  Candidatus Methanosphaerula palustris
Pathway
mpl00010  Glycolysis / Gluconeogenesis
mpl00230  Purine metabolism
mpl00620  Pyruvate metabolism
mpl01100  Metabolic pathways
mpl01110  Biosynthesis of secondary metabolites
mpl01120  Microbial metabolism in diverse environments
mpl01130  Biosynthesis of antibiotics
mpl01200  Carbon metabolism
mpl01230  Biosynthesis of amino acids
Module
mpl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mpl_M00002  Glycolysis, core module involving three-carbon compounds
mpl_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpal_1867
   00620 Pyruvate metabolism
    Mpal_1867
  Nucleotide metabolism
   00230 Purine metabolism
    Mpal_1867
Enzymes [BR:mpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Mpal_1867
Membrane trafficking [BR:mpl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Mpal_1867
Exosome [BR:mpl04147]
 Exosomal proteins
  Proteins found in most exosomes
   Mpal_1867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI Glyco_hydro_97 Peptidase_C25
Motif
Other DBs
NCBI-ProteinID: ACL17172
UniProt: B8GKM6
LinkDB All DBs
Position
1981861..1983294
Genome map
AA seq 477 aa AA seqDB search
MNKTKIVCTIGPSSSSPQVLADMIRSGMNVARVNFSHGTSDEHRKMIRSIRAVATRLGRT
VAILVDLPGPKIRIGRLRLEPTILKRGETITLTTDPASSNLTAIPVDYPDLPSLVTEGTT
IYLNDGFLQVKVVRTSEQEVDAKVVIGGPLLSHKGLNLPGVALSIAAVTPEDLAHVDIGL
DEGVDTFTISFLERPEDIRILREYAQKRGIKIHIVAKIERAGAVREIDAILAEADAIMIA
RGDLGVQIPIEDVPGVQKQCILKANRLGVPVITATQMLESMTENILPTRAEVTDVANAIL
DGSDAVMLSAETATGRYPVETVRMMAKIARSIEAQRTMLKGRSQLEEVLLLTGINRRELT
VDDVVSLNVIQAMHALSPRYILTPTRSGRAPRRISRFKPDCWILSFCRDQKVAEFLAFSY
GVVPFFVKTDEASWHDRIFDLISDAGLAKTGDLVILTEGSEPDLAGATNSLRIIKFP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaataagacaaagatcgtctgtacaatcggtccctcatcctcatcaccacaggtgctt
gctgacatgatccgaagcggaatgaatgtggcccgggtgaacttctcccacggaacgagc
gatgagcacaggaaaatgatacgaagtatcagagcagtcgccactcgcctcgggaggacg
gtggcaattcttgttgacctcccaggcccaaagatcaggatcggcaggttgagactggaa
ccaacgatcctgaagaggggggagacgatcacattaaccacggacccggcctcttcgaac
ctgaccgcgatcccggtggattaccccgacctcccctcactcgtcaccgaagggaccacg
atctatctgaacgacgggtttctgcaggtgaaggtagtccgaaccagcgaacaggaggtg
gatgcaaaggtcgtgatcggtggaccgctcctctcacataagggactgaatctgccaggg
gtcgccctgtcgatcgccgcagtgaccccggaggatctcgcccatgtcgatattggactg
gatgaaggagtcgacaccttcaccatctcattccttgagcgcccggaagatatcaggata
ctccgggagtatgcacagaagcggggcataaagatccatatcgtcgcaaagatcgaacgg
gctggagcggtcagggagatcgacgccattcttgccgaagcagatgccatcatgatcgca
cgtggcgacctgggcgttcagattccgatcgaggatgtgcctggagttcagaaacaatgt
atcctgaaggcaaaccggctcggggtgccggtgatcaccgccacccagatgctcgaatcg
atgacagaaaatatcctcccgacaagagccgaagtgaccgatgtagccaacgcaattctg
gatgggtccgatgccgtgatgctctccgctgagacagccaccggcaggtacccggttgag
acggtgcgcatgatggcaaagatcgcacgatcgatagaagcccagcggacaatgttgaag
ggccgttcccagcttgaggaggtgctgctgcttaccgggatcaacaggcgcgaactgacg
gtcgacgatgtggtctccctgaacgtgatccaggcgatgcacgccctctcaccccggtat
atcctgacccccaccaggagcgggagggcgccgagacggatatcccgtttcaaaccggac
tgctggatcctttcgttctgcagggatcagaaggttgccgagttcctcgccttctcctac
ggcgtggtgccgttctttgttaaaaccgatgaggcatcctggcacgacagaatctttgat
ctgatcagtgatgccggacttgcgaagaccggagatctcgtgatcctgacagaagggtcg
gaaccggatctggcaggagcgaccaactccctgcggatcatcaaattcccctga

DBGET integrated database retrieval system