KEGG   Massilia plicata: E1742_17110Help
Entry
E1742_17110       CDS       T06563                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mpli  Massilia plicata
Brite
KEGG Orthology (KO) [BR:mpli00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E1742_17110 (ahpF)
Enzymes [BR:mpli01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E1742_17110 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored Thi4 FAD_binding_3 NAD_binding_8 Glutaredoxin K_oxygenase Thioredoxin_9 FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: QBQ37700
LinkDB All DBs
Position
3912695..3914284
Genome map
AA seq 529 aa AA seqDB search
MLDANLKTQLKAYLEKVVQPIEIVASLDDSAKAREMQELLADIEGLSDKITVVEDSTGAV
RRPSFSINRAGSDIGVRFAGIPMGHEFTSLVLALLQVGGHTIKLDEATIEQIRNLDGDYE
FETFISLSCHNCPEVVQALNAMSVINPRIKVTTIDGGVFQKEVEDRQIMAVPMMFLNGEH
FGQGRTNVEEILAKLDTNAGARQAAELNKKDVFDVLIVGGGPAGAASAIYAARKGIKTGV
LAERFGGQVLDTLAIENFVSIKETDGPKFAVALEQHVKEYEVDIMNTQRAVKLVPGKVAE
VHTATGAVLKAKTVILSTGARWREINVPGEKEYRNHGVAYCPHCDGPLFKGKRVSVIGGG
NSGVEAAIDLAGIVQHVTLIEFGTELRADAVLQRKLHSLPNVKVILSAQTTEIHGDGKKV
NGLSYKDRNTNELHRVDLEGVFVQIGLVPNTEWLKGTVALSKHGEIEIDPRGQTSVPGVF
AAGDVTTVPYKQIVIAVGEGAKAALSAFDHLIRSDDEVEAEQEKIAAAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgcaaatctcaaaacccaactgaaagcctatctggaaaaagtggtgcagccg
attgagatcgtcgcatcgctggatgactccgccaaagcgcgggaaatgcaggaattgctc
gccgatatcgaaggcttgagcgacaagattaccgtggtcgaggactccactggcgccgtg
cgccgtccatcgttctcgatcaaccgtgccggcagcgacatcggtgtgcgcttcgcaggt
atcccaatgggccatgagttcacctcgctggtgctggctctgctgcaagtcggcggccat
acgatcaagctggacgaggcgacgatcgaacagatccgcaacctcgacggcgactacgaa
ttcgagaccttcatctcgctgtcgtgccacaattgcccggaagtggtgcaggcactgaac
gcgatgtcggtcatcaacccacgcatcaaagtgacgaccatcgacggtggcgtgttccag
aaggaagtcgaagaccgccagatcatggccgtgccgatgatgttcctgaacggcgaacac
ttcggccagggccgcacgaatgtggaagaaattctggcgaagctggacaccaatgcgggt
gcccgccaggctgctgaactgaacaagaaagacgtgttcgacgtactgatcgtcggcggc
ggccctgccggcgcggcgtccgcgatctacgcggcccgcaaaggcatcaagacgggtgtg
ctggccgagcgtttcggcggccaggtgctggataccctggcaatcgagaacttcgtgtcg
atcaaggaaaccgacggcccgaaattcgccgttgccctggagcagcacgtcaaggaatat
gaagtcgacatcatgaacacccagcgtgccgtcaagctggtgccgggcaaggtcgccgaa
gtgcacaccgccaccggtgccgtactaaaggcaaagaccgtgatcctgtcgacgggtgcc
cgctggcgcgaaatcaacgtgccgggcgagaaggaatatcgcaatcacggcgtggcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtgtccgtgattggcggcggc
aactccggcgtggaagcggccatcgacctggccggtatcgttcagcacgtcacgctgatc
gagttcggtacggaactgcgtgcggatgccgtgctgcagcgcaagctgcactcgctgccg
aacgtcaaggtgatcctgtcggcgcagacgacggagatccatggcgacggcaagaaggtc
aacggcctgtcgtacaaggaccgcaatacgaacgagctgcaccgtgtcgacctggaaggt
gtgttcgtgcagatcggcctggtgccgaacaccgaatggctgaagggtaccgtggcgttg
tcgaagcacggcgagatcgagatcgatccacgcggccagacgtcggtgccgggcgtgttc
gccgctggcgacgtgacgaccgtgccgtacaagcagatcgtcatcgccgtcggcgagggc
gcgaaggcggcactgtccgcgttcgatcacctgatccgctcggacgatgaagtcgaagcc
gagcaggaaaagatcgccgccgcggcataa

DBGET integrated database retrieval system