KEGG   Methylorubrum populi: Mpop_0261Help
Entry
Mpop_0261         CDS       T00760                                 

Definition
(GenBank) Transketolase central region
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
mpo  Methylorubrum populi
Pathway
mpo00030  Pentose phosphate pathway
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
mpo01230  Biosynthesis of amino acids
Module
mpo_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
mpo_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mpop_0261
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Mpop_0261
Enzymes [BR:mpo01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Mpop_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr Transketolase_C PFOR_II
Motif
Other DBs
NCBI-ProteinID: ACB78446
UniProt: B1ZH41
LinkDB All DBs
Position
270298..271317
Genome map
AA seq 339 aa AA seqDB search
MRRSKYEKPAPRASGGAKTSAMIASLAAPGQRTKPAPFGNALLELAKTRPDVVGLSADLA
KYTDLHIFAQAHPDRFYQMGMAEQLLMSAAAGLAREGFTPIATTYAVFAARRAYDFICLA
IAEENLNVKIACALPGLTTGYGPSHQATEDLAIFRGMPNLTILDPCDAHELEQIVPAMVE
HQGPVYLRLLRGNVPLVLDEYGYTFEWGKAKTIHDGGDVLIVSTGLMTMRALEVAQELRD
DRIDVAVLHVPTIKPLDEETILREVGRGGRLVVVAENHSVVGGLGEAVAGLLLRTGTVPP
GYRQIGLPDEFLDAGALPTLHERYGISTQAMARSISGWL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgttcgaagtacgagaagcctgccccgcgcgcgtccgggggagccaagacctcg
gcaatgatcgcgtccctggccgcgcccggccagcgcacgaagccggcgcccttcggcaat
gccctactcgaactcgccaagacgcgccccgatgtcgtcggtctgtcggcggacctcgcc
aagtacaccgacctgcacatcttcgcgcaggctcaccccgaccggttctaccagatggga
atggccgagcagcttctgatgagcgcggcggcggggctcgctcgcgaaggcttcacgccc
atcgccacgacttacgcggtgttcgcggcgcggcgcgcctacgacttcatctgcctcgcg
atcgccgaggagaacctcaacgtcaagatcgcctgcgccctgccgggcctcacgacgggc
tacggcccgagccatcaagccaccgaggatctcgcgatcttccgcggcatgccgaacctg
acgatcctcgacccctgcgatgcgcatgaattggagcagatcgtgccggccatggtcgag
caccagggtccggtctacctgaggctgctgcgcggcaacgtgcctctcgtgttggacgag
tacggctacaccttcgagtggggcaaggccaagacgatccatgacgggggcgacgttctg
atcgtctcgaccggactgatgaccatgcgggccctcgaggtcgcccaggaactccgcgac
gaccggatcgacgtcgcggtgctgcacgtgccgaccatcaagccgctcgatgaagagacc
atcctgcgcgaggtcggccgcggcggccggctcgtcgtggtggccgagaaccactccgtg
gtcggcggcctcggcgaggcggtggcgggcctgctcctgcgcaccggcacggtgccgccg
ggctaccgccagatcggcctgcccgacgaattcctcgacgcgggcgccctgccgaccctg
cacgagcgctacggcatctccacccaggcgatggcccgcagcattagcggctggctctga

DBGET integrated database retrieval system