KEGG   Methylorubrum populi: Mpop_0750Help
Entry
Mpop_0750         CDS       T00760                                 

Definition
(GenBank) Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)), Phosphate acetyltransferase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
mpo  Methylorubrum populi
Pathway
mpo00620  Pyruvate metabolism
mpo01100  Metabolic pathways
mpo01120  Microbial metabolism in diverse environments
mpo01200  Carbon metabolism
Module
mpo_M00169  CAM (Crassulacean acid metabolism), light
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpop_0750
Enzymes [BR:mpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     Mpop_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M ELFV_dehydrog AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACB78928
UniProt: B1Z745
LinkDB All DBs
Position
807237..809567
Genome map
AA seq 776 aa AA seqDB search
MADNMSEDLKSGALVYHRLPKPGKLEIQATKPLGNQRDLALAYSPGVAAACMAIHDDPQE
AATLTIRQNLVAVLSNGTAVLGLGDIGPLASKPVMEGKAVLFKKFAGIDVFDIEVDQKDV
DKLVDVVCSLEPTFGGINLEDIKAPECFEVEERCRERMNIPVFHDDQHGTAIIVAAAVLN
ALELAGKQLSDAKIVTSGAGAAALACLNLLVSLGATRENITVTDIKGVVYKGRAELMDRW
KDIYAQETEARTLADVIPGADVFIGLSAGGVLKPEYLEKMAEKPLIMALANPYPEIMPDV
AEQARPDAMICTGRSDFPNQVNNVLCFPYIFRGALDVGAHKINEEMKKAAVKAIAALARE
TPSDVVARAYGGEARPFGPRSLIPSPFDPRLILRIAPAVAKAAMDSGVAGRPVENIQAYA
ESLDRFVHRSGFIMKPLFSKAKTDPKRVIYAEGEDERVLRAAQAVVEDKVARPILVGRPR
VIETRIKRFGLDLKPGEHFDLIDPEDDPRYRDYVATYLEVAGRRGITPDLARTLVRTNST
VIAALAVRRGEADALICGLEGRFETRLRVIRDIIGLSPDSLDFAGMSLIVTKKGAFFLAD
THVRQNPSAEEIADVAIACANHVGRFGLTPKIALLSHSDFGQSDSDSAKKMRKALELIQT
RAPQLQADGEMQADSALSELVRDRVLPGSNWKGAANILVFPNLDAANIAFQFAKVLADAL
PVGPLLIGPAKPAHILTPSVTARGIVNVTAAAVVEAQAGEPQEAAEAEPGAGPISE
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaacatgtccgaggatctgaaatccggggcgctcgtctaccaccgactgccg
aaacccggaaagctcgagatccaggcgacgaagcctctcggtaatcaacgcgatctggcg
ctggcttattcccccggcgtcgccgccgcctgcatggcgatccacgacgacccgcaggag
gccgcaaccctcaccatccgtcagaacctcgtcgcagtgctctcgaacggcaccgcggtg
ctgggcctcggcgatatcggcccgctggcctcgaagccggtgatggagggcaaggcggtc
ctgttcaagaagttcgccgggatcgacgtgttcgacatcgaggtcgaccagaaggacgtc
gacaagctggtggacgtggtctgctccctggagccgaccttcggcgggatcaaccttgag
gacatcaaggcgccggaatgcttcgaggtcgaggagcgttgccgggagcggatgaacatc
ccggtcttccacgacgaccagcacggcacggcgatcatcgtcgcggcggccgtcctcaac
gcgctcgaactcgccggcaagcagctctccgacgccaagatcgtcacctccggcgccggc
gcggcggcgctcgcctgcctcaacctcctggtttccctcggcgcgacccgcgagaacatc
accgtcaccgacatcaagggcgtggtctacaagggccgggccgaactgatggaccgctgg
aaggacatctacgcgcaggagacggaggcgcggacgctcgccgacgtgatcccgggtgcc
gacgtgttcatcggcctctcggcgggcggcgtgctcaagcccgaatatctcgagaagatg
gccgagaagccgctcatcatggcgctcgccaacccctatcccgagatcatgccggacgtc
gccgagcaggcgcggccggatgcgatgatctgcaccgggcgctcggatttccccaatcag
gtcaacaacgtcctctgcttcccctacatcttccgcggcgcgctcgatgtcggcgcccac
aagatcaacgaggaaatgaagaaggccgcggtgaaggcgatcgccgcgctcgcccgcgag
acgccctccgacgtggtcgcccgcgcctatggcggcgaggcccggccgttcgggccccgc
tcgctgatcccgagcccgttcgatccgcgcctgatcctgcgcatcgcgccggccgtggcc
aaggcggcgatggattcgggcgtcgccgggcggccggtcgagaacatccaggcctacgcg
gaatcgctcgaccgcttcgtgcaccgctccggcttcatcatgaagccgctgttctccaag
gcgaagacggatccgaagcgcgtcatctacgccgagggcgaggacgagcgggtgctgcgc
gcggcgcaggcggtcgtcgaggacaaggtcgcgcggccgatcctggtcggacgtccgcgg
gtgatcgagacccgcatcaagcgcttcggcctcgacctgaagcccggcgagcatttcgac
ctgatcgatcccgaggacgatccgcgctaccgggactacgtcgccacctatctcgaggtc
gccgggcggcgcggcatcacgccggatctcgcccggacgctggtgcgcaccaacagcacg
gtgatcgcggcgctggcggtccgccgcggcgaggcggacgcgctgatctgcggcctggaa
ggccggttcgagacgcggctgcgtgtcatccgcgacatcatcgggctctcgcccgattcg
ctcgatttcgccggcatgagcctgatcgtgacgaagaagggcgccttcttcctcgccgac
acccatgttcgccagaacccgagcgcggaggagatcgccgacgtcgccatcgcctgcgcc
aaccatgtcggtcgcttcggtctgaccccgaagatcgcgctgctgagccactccgatttc
gggcagtcggactcggactcggcgaagaagatgcgcaaggccctggagttgatccagacc
cgcgcaccgcagcttcaggccgacggcgagatgcaggcggattcggcgctgtccgaactc
gtgcgcgaccgggtgctgccgggctccaactggaagggtgcggccaacatcctcgtcttc
ccgaacctggatgcggccaacatcgccttccagttcgccaaggtgctggccgatgccctg
ccggtcggcccgctgctgatcggcccggccaagccggcgcacatcctgacgccctcggtc
acggcccgcggcatcgtcaacgtcaccgccgcggcggtggtggaggcacaggccggggag
ccgcaggaagcggcggaggccgagccgggcgccgggccgatctcggagtag

DBGET integrated database retrieval system