KEGG   Methylorubrum populi: Mpop_3262Help
Entry
Mpop_3262         CDS       T00760                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mpo  Methylorubrum populi
Pathway
mpo00970  Aminoacyl-tRNA biosynthesis
mpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mpop_3262
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mpo03029]
    Mpop_3262
Enzymes [BR:mpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Mpop_3262
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Mpop_3262
Mitochondrial biogenesis [BR:mpo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mpop_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: ACB81413
UniProt: B1ZIK6
LinkDB All DBs
Position
complement(3487335..3488807)
Genome map
AA seq 490 aa AA seqDB search
MTERVDPKKLIKGGLHDWEVVIGMEIHAQVTSRSKLFSGASTAFGGEPNDHVSLVDAAMP
GMLPVINEECIAQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQISQYKDPIVGEGEV
LVDLPDGESITVGIERLHLEQDAGKSLHDQDPTKSFVDLNRSGVALMEIVSRPDLRSSEE
AKAYVTKLRTILRYLGTCDGDMEKGSLRADVNVSVRRPGEPLGTRCEIKNVNSIRFIGQA
IETEARRQIAILEDGGKIDQETRLFDPGKGETRSMRSKEEAHDYRYFPDPDLLPLEFDQA
YVDGLASGLPELPDAKKARFIKDFGLSAYDAGVLVAERASADYFEAVARGRDGKAAANWV
INELFGRLNKEGRSIEDTPVSAEQLGTIVDLIGEGVISGKIAKDLFEIVWSEGGDPRAIV
ESRGMKQVTDTGAIEAAVDAIIAANPDKVEQAKAKPTLLGWFVGQTMKATGGKANPAAVN
ALLKDKLGIE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcgtcgatccgaagaagctcatcaagggcggcctgcacgactgggaggtc
gtgatcgggatggagatccacgcccaggtcaccagccgctccaagctgttctccggcgcc
tccaccgccttcggcggcgagcccaacgaccacgtctcgctggtcgatgcggccatgccg
ggtatgctgcccgtcatcaacgaggaatgcatcgcccaggccgtccgcaccggtctcggc
ctgaaggcgcagatcaacctgcgctcggtgttcgaccggaagaactacttctacccggac
ctgccgcagggctaccagatctcacagtacaaggacccgatcgtcggtgagggcgaggtg
ctggtcgatctgcccgacggcgagtcgatcacggtgggcatcgagcgcctgcatctggag
caggatgccggcaagtccctgcacgaccaggatccgaccaagagcttcgtcgatctcaat
cgctccggcgtggcgctgatggagatcgtctcgcgccccgatctccgctcgtcggaggag
gccaaggcctacgtgaccaagctgcgcacgatcctgcgctatctcggcacctgcgacggc
gacatggagaagggcagtctccgcgccgacgtgaacgtctccgtgcgccgccccggcgag
ccgctcggcacgcgctgcgagatcaagaacgtcaactcgatccgctttatcggccaggcc
atcgagaccgaggcacgccgccagatcgcgatcctggaggatggcggcaagatcgatcag
gagacgcgcctgttcgatccgggcaagggcgagacccgctcgatgcgctcgaaggaggag
gcgcacgactaccgctacttccccgaccccgatctgctgccgctcgaattcgaccaagcc
tatgtcgatgggctggcctcaggcctgccggaactgccggatgccaagaaggcccgcttc
atcaaggatttcggccttagcgcctacgatgccggcgtgctcgtcgccgagcgggcgtcg
gccgattatttcgaggcggtggcgcgtggccgcgacggcaaggccgcggccaactgggtg
atcaacgaactgttcggacgcctcaacaaggaggggcgctcgatcgaggacacgccggtc
tccgccgagcagctcggcaccatcgtcgatctcatcggcgagggcgtgatctccggcaag
atcgccaaggatctgttcgaaatcgtctggtccgagggcggcgacccgcgcgcgatcgtc
gagtcccgcggcatgaagcaggtcaccgataccggcgccatcgaggcggcggtggacgcg
atcatcgccgccaaccccgacaaggtggagcaggccaaggccaagccgactctgctcggc
tggttcgttggccagacgatgaaggcgacgggcggcaaggccaacccggccgcggtcaac
gccctcctcaaggacaagctcgggatcgagtag

DBGET integrated database retrieval system