KEGG   Methylobacterium populi: Mpop_3432Help
Entry
Mpop_3432         CDS       T00760                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mpo  Methylobacterium populi
Pathway
mpo03030  DNA replication
mpo03410  Base excision repair
mpo03420  Nucleotide excision repair
mpo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mpop_3432
   03410 Base excision repair
    Mpop_3432
   03420 Nucleotide excision repair
    Mpop_3432
   03430 Mismatch repair
    Mpop_3432
Enzymes [BR:mpo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mpop_3432
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mpop_3432
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mpop_3432
DNA replication proteins [BR:mpo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mpop_3432
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mpop_3432
DNA repair and recombination proteins [BR:mpo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mpop_3432
   NER (nucleotide excision repair)
    Other NER factors
     Mpop_3432
   MMR (mismatch exicision repair)
    Other MMR factors
     Mpop_3432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N
Motif
Other DBs
NCBI-ProteinID: ACB81583
UniProt: B1ZKL3
LinkDB All DBs
Position
3659566..3661296
Genome map
AA seq 576 aa AA seqDB search
MNDFAHLLDRLAYEPRRNAKLRLLQDFFAGTPDPERGWALAAMTGGLTFREAKPALIRAL
VEERVDPVLFSLSHNYVGDLAETTALIWPGPEQDPPPSAREGSPGPGHNNPPPSVPTLAE
VVETLATTPKRALPQHLTRWLDALDETGRWALLKLVTGNLRVGVSARLAKTAVGALGGHE
ADAVEEVWHGLKPPYPELFAWVEGRGERPESRNPAPFRPPMLSHPVEEFEDLDKLEPEAF
SAEWKWDGIRVQLAGGRDNQGRQVQKIYSRTGEDISDAFPDLAEAITFDGAIDGELLILR
EGRVQSFNVLQQRLNRKAVTGKLLDEFPAHVRAYDVLSAEGEDLRGLPFAERRPRLETLV
RQLDHARIDLSPLVPFATWNEVAAARADPASAGAGADADAIEGVMLKRLNSPYLPGRPKG
PWWKWKREPYVVDAVMMYAQRGHGKRSSFYSDYTFGCWREGAEGEELVPVGKAYHGFTDA
ELQKLDRYVRNHTTKRFGPVREVAYGRDAGLVLEIAFEGVQRSTRHKSGVAMRFPRVSRI
RWDKPAAEADRVEVLERILARGEREVAPGAAMEASE
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgacttcgcccatctcctcgaccgcctcgcctacgagccgcgccgcaacgccaag
ctgcgcctgctccaggatttcttcgccggcacgcccgatcccgagcgcggctgggcgctg
gctgccatgaccggcgggctgaccttccgcgaggccaagccggccctgatccgcgccctg
gtggaggagcgggtcgatccggtgctgttctcgctctcgcacaactacgtcggtgatctc
gccgagacgacggcgctgatctggccggggccggaacaggatccgcccccctccgcgcgg
gagggatcccccggccccggccacaacaatccgcctccatcggtccccaccctcgccgag
gtcgtcgagacgctggccaccactccgaagcgcgccctgccgcagcatctcacgcgctgg
ctcgacgccctcgacgagaccgggcgctgggcgctcctcaagctcgtcaccggcaacctg
cgcgtcggcgtctcggcgcgcctcgccaagaccgccgtcggcgcactcggcggccacgag
gcggatgcggtggaggaggtctggcacgggcttaagccgccctatcccgagctgttcgcc
tgggtggagggccggggcgagcggcccgagagccggaacccggcccccttccgtccaccg
atgctctcccatccggtcgaggaattcgaagacctcgacaagctcgagcccgaagccttc
tcggccgagtggaagtgggacggcatccgcgtccagctcgcgggcgggcgcgacaatcag
ggacgccaagtccagaaaatctactcccgcaccggcgaggacatttccgacgccttcccc
gatctcgccgaggcgatcaccttcgacggcgcaatcgacggcgagttgctgatcctgcgg
gaaggccgggtgcagagcttcaacgtgctgcagcagcggctcaaccggaaggcggtgacg
ggtaagctgctcgacgagttccccgcccatgtccgcgcctacgacgtgctctcggccgag
ggcgaggatctgcgcggcctgcccttcgccgagcggcggccgcggttggagaccctggtg
cggcagctcgaccatgcccgcatcgacctctcgccgctcgtccccttcgcgacctggaac
gaggtggcggcggcccgcgccgatccggcctccgcgggcgccggcgccgatgccgacgcc
atcgagggcgtgatgctcaagcggctcaacagtccctacctgcccggccggccgaagggc
ccgtggtggaagtggaagcgcgagccctacgtggtcgatgcggtgatgatgtacgcccag
cgcggtcacgggaagcgctcgtccttctactcggactacaccttcggctgctggcgcgag
ggcgcggagggcgaggagctggtaccggtgggcaaggcctatcacggtttcaccgacgcc
gagctgcagaagctcgaccgctatgtccgcaaccacacgacgaagcgcttcggcccggtg
cgcgaggtcgcctacggccgcgatgccggcctcgtgctggagatcgccttcgagggcgtg
cagcgctcgacccggcacaaatccggcgtggcgatgcgcttcccccgcgtcagccgcatc
cgctgggacaagcccgcggcggaggccgaccgggtcgaggtgctggagcggatcctggcc
cgcggcgagcgcgaggtcgcgccgggggcggcgatggaggcatcggaatga

DBGET integrated database retrieval system