KEGG   Methylorubrum populi: Mpop_3616Help
Entry
Mpop_3616         CDS       T00760                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mpo  Methylorubrum populi
Pathway
mpo00010  Glycolysis / Gluconeogenesis
mpo00620  Pyruvate metabolism
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpop_3616
   00620 Pyruvate metabolism
    Mpop_3616
Enzymes [BR:mpo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mpop_3616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ACB81765
UniProt: B1Z7G2
LinkDB All DBs
Position
3862379..3863902
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWVAPVSGRYFENTSPITGKVICEVARSEAQDIE
KALDAAHAAKDAWGRTAPAERARILNKIADRMEDNLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASNPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVANEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARGTREGELADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcctgaattcctggctgacgccaagaccaagtcgcccttctcggcgcgctac
gacaacttcatcggcggccagtgggtggcgccggtgagcggccgctacttcgagaacacc
tccccgatcaccggcaaggtgatctgcgaggtcgcccgctccgaggcgcaggacatcgag
aaggcgctcgacgccgcccacgccgccaaggacgcctggggccgcaccgccccggccgag
cgcgcccgcatcctcaacaagatcgccgaccggatggaggacaacctcgatctgatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagaccaccgccgccgacatcccg
ctcgccatcgaccactggcgctacttcgccagctgcgtgcgcgcccaggaaggcgcgatc
tccgagatcgaccacgacacggtcgcctaccacttccacgagccgctcggtgtcgtcggc
cagatcatcccgtggaacttccccatcctgatggcggtgtggaagctcgccccggcgctc
gccgccggcaactgcgtggtgctcaagcccgccgagcagaccccggcctcgatcctcgtg
gtgatggagctgatcggcgacctgctgccgccgggcgtgatcaacgtcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcgaacccgcgcatcgccaaaatcgccttcacg
ggtgagacgaccaccggccgcctcatcatgcagtacgcctcgcagaacctgatcccggtg
acgctggagctgggcggcaagtcgccgaacatcttcttcggcgacgtcgccaacgaggac
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgag
gtctgcacctgcccgagccgcgcgctggtgcacgagtcgatctacgaccgcttcatcgag
cgcgcgatcaagcgcgtcgaggcgatcacccagggctcgcccctcgacccggcgaccatg
atcggcgcccaggcctcgtccgagcagctggaaaagatcctgagctacgtcgatatcggc
cgccaggaaggcgccgagtgcctcaccggcggcgcccgcggcacccgcgagggcgagttg
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctctcggtcacgaccttcaaggacgacgaggaggcg
ctctccatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacgga
acccgcgcctaccgcttcggccgcgccatccaggccggccgcgtctggacgaactgctac
cacgcctacccggcgcacgcggccttcggcggctacaagcagtccggcatcggccgcgag
acccacaagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctactcc
tcgaagaagctcgggttcttctga

DBGET integrated database retrieval system