KEGG   Methylobacterium populi: Mpop_4534Help
Entry
Mpop_4534         CDS       T00760                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mpo  Methylobacterium populi
Pathway
mpo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mpo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mpop_4534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpo02000]
    Mpop_4534
Enzymes [BR:mpo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mpop_4534
Transporters [BR:mpo02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mpop_4534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C_3 GST_C GST_C_2 GST_N DUF1490
Motif
Other DBs
NCBI-ProteinID: ACB82632
UniProt: B1ZGV4
LinkDB All DBs
Position
complement(4841407..4842135)
Genome map
AA seq 242 aa AA seqDB search
MTYELHYWPMIPGRGEFVRLALEQAGADYIDVARRPEAQGGGIAAMMERLEDEPVRPPFA
PPFLKDGDRVIGQTAAILLYLGPRLGLVGEDEADRVWTHQIQLTIADMVAEAHDTHHPVG
VGLYYEDQKPEARRRAEDFCENRIPKFLGWFERVLAGNPAGPAHLVGGAVSYADTSLFQL
VEGLRYAFPRAASRALAQAPHVAAHAERIGQLPRIAAYRASERCLPFNEQGIFRHYPELD
FG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgacctacgagctgcattactggccgatgatccccggtcggggcgagttcgtacggctc
gccctcgaacaggccggcgcggattacatcgatgtcgcccgccggcccgaggcgcagggc
ggcggcatcgcggcgatgatggagcgcctggaggacgaaccggtccgcccgccctttgcc
ccgccctttctcaaggacggcgaccgcgtgatcggccagactgcagcgatcctgctctat
ctcgggccgcgcctcggcctcgtcggcgaggatgaggccgaccgggtctggacgcaccag
atccagctcaccatcgccgacatggtggcggaggcgcacgacacccatcacccggtcggc
gtcggcctgtactacgaggaccagaagcccgaggcgcgtcgccgcgccgaggatttctgc
gagaaccgcattccgaaattcctgggctggttcgagcgggtgctcgccggcaacccggcg
gggccggcgcatctggtgggcggcgcggtcagctatgccgacacctcgctgttccagctc
gtggagggcctgcgctacgcctttccccgcgccgcctcccgcgccctggcacaggcgccg
cacgtcgccgcccatgcggagcggatcgggcagctaccccgcatcgcggcctaccgcgcc
agcgagcgctgccttcccttcaatgagcagggcatcttccggcactacccggagctcgat
ttcggctga

DBGET integrated database retrieval system