KEGG   Micromonas pusilla: MICPUCDRAFT_16166Help
Entry
MICPUCDRAFT_16166 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mpp  Micromonas pusilla
Pathway
mpp03030  DNA replication
mpp03410  Base excision repair
mpp03420  Nucleotide excision repair
mpp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MICPUCDRAFT_16166
   03410 Base excision repair
    MICPUCDRAFT_16166
   03420 Nucleotide excision repair
    MICPUCDRAFT_16166
   03430 Mismatch repair
    MICPUCDRAFT_16166
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mpp03032]
    MICPUCDRAFT_16166
   03400 DNA repair and recombination proteins [BR:mpp03400]
    MICPUCDRAFT_16166
Enzymes [BR:mpp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MICPUCDRAFT_16166
    6.5.1.6  DNA ligase (ATP or NAD+)
     MICPUCDRAFT_16166
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MICPUCDRAFT_16166
DNA replication proteins [BR:mpp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MICPUCDRAFT_16166
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MICPUCDRAFT_16166
DNA repair and recombination proteins [BR:mpp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MICPUCDRAFT_16166
   NER (nucleotide excision repair)
    Other NER factors
     MICPUCDRAFT_16166
   MMR (mismatch exicision repair)
    Other MMR factors
     MICPUCDRAFT_16166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 9683529
NCBI-ProteinID: XP_003057721
JGI: 16166
UniProt: C1MQA0
LinkDB All DBs
AA seq 682 aa AA seqDB search
MAGGKRAAAAATKKKKSSKKKAKQEANAAGVGDKSVEAAGRLLSYDPAKPVTWKSGEPVP
YLFLAEIFESISETTKRLEIAELLTNAFRTILAAGTPEDLLAAVYLASNTIAPQHEGVDL
GIGDATLIKMLAEATGRKESAIKSDYTKEGDLGIVAMMSRSTQSMMFAPPKLTIVGVLKE
FRAIAKTEGTKSVDQKKGKIKKLLVAARECEAGYVTRSLQGKLRIGLAQQTVTTALAHAV
VLHAETKDGKCADGKTHAELADRLGAAVDVLKQVFSECPSFDEIVPALLMDGGIDKLAER
CHFRPGVPVKPMLAKPTCGVSEVLQRFSDVEFTCEYKYDGERAQIHLCEDGAVKIFSRNQ
EDNTPKFPDVIRALPTYLQEGVKSVVIDCEAVAFDRAEGKILPFQILSTRGRKNIDEKDI
KVNVALYAFDCLYLNGENLLQKPMMERRKALYSAFKEVPGEFFFATAKVSRDVEELQVFL
EDSIKENTEGLIVKTLDATYEPSKRSLNWLKLKKDYMEGCGDSLDLVPIGAFHGRGKRTG
VYGAYLLACYDEESEELQSICKIGTGFSDEALESLSNSLKDTVIDAPRGYYKYGESVAPD
VWFAASQVWEVKAADLSISPTHMAAHGLVDSTKGIALRFPRFLRVREDKTPETATSAEQV
ADFYNAQATKQEFNNGGDDDEF
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggccggcggcaaacgcgccgccgccgcggccaccaagaaaaagaagtcgtccaagaag
aaagcgaagcaggaggcgaacgccgccggcgtcggggacaagtccgtcgaagccgcgggc
cggctgttatcctacgaccccgcgaagccggtgacgtggaaatccggcgaacccgtgccg
tacctgttcctcgcggagattttcgaatccatctccgagacgacgaaacgcctcgagatc
gcggagctcctgacgaacgcgttccggacgatcctcgccgcggggacgccggaggattta
ctcgccgcggtgtacctcgcgtccaacacgatcgcgccgcagcacgagggcgtcgacttg
ggcatcggagacgcgacgctcatcaagatgctcgccgaggcgacgggacggaaagagagc
gccatcaagagcgactacacgaaagagggcgacctcgggatcgtcgcgatgatgtccagg
agcacgcagagcatgatgttcgcgccgccgaagttgacgatcgtgggcgtgttgaaagag
ttccgcgcgatcgcgaagacggagggcacgaagagcgtggatcagaagaagggaaagatc
aaaaagctcctcgtcgccgcgcgcgagtgcgaagccggatacgtcacgcgctcgctgcag
gggaagctccgcatcgggctcgcgcagcagacggtgacgaccgcgctcgcgcacgcggtc
gtgcttcacgcggagacgaaggacgggaagtgcgccgacggaaagacgcacgcggagctc
gcggaccgcctcggcgccgccgtcgacgtcttgaagcaagtcttcagcgagtgcccgtcc
ttcgacgagatcgtgccagcgttgctcatggacggcgggatcgataagctcgcggagcgg
tgccactttcgaccgggggtgccggtgaagccgatgctcgcgaagccgacgtgtggggtc
tccgaggtgcttcaacgtttcagcgacgtcgagttcacgtgcgagtataagtacgacggc
gaacgcgcgcagattcacctttgcgaagacggcgcggtgaaaattttctcgcggaaccag
gaggacaacaccccgaagttcccggacgtgattcgtgcgctgccgacgtacttacaagag
ggcgtgaagtccgtcgtcatcgactgcgaggctgtcgcgttcgaccgcgcggaggggaag
attctgccgtttcagattctctccacgcgcgggcggaaaaacatcgacgaaaaggatatc
aaagtcaacgtcgcgttgtacgcgttcgattgtctgtacctcaacggcgagaacttgctt
cagaagccgatgatggagcgacggaaggcgctgtacagcgcgttcaaggaagtcccgggg
gagttcttcttcgcgaccgcgaaagtttcgagggacgtcgaggagctgcaggtgttctta
gaggactccatcaaggaaaacaccgaaggtctcatcgtcaagacgctagacgcgacgtac
gagccgtcgaaacgatcgctgaactggctgaaactgaagaaggactacatggaaggctgc
ggggactcgttagacctcgtcccgatcggcgcgttccacggccgcgggaaacgaaccggc
gtgtacggcgcatacctcctcgcgtgctacgacgaagagagcgaggagctgcagtcgatt
tgcaaaatcggcacggggttcagcgacgaggcgctcgagtcgttgtccaactcgctgaag
gacacggtcatcgacgcgccgcgggggtattacaagtacggcgagtccgtcgccccggac
gtgtggttcgccgcgtcgcaggtgtgggaggtgaaagccgcggatttgtcgatatcgccg
acgcacatggccgcgcacggattggtcgactcgacgaagggcatcgcgttacggtttccg
cggtttttacgcgtcagggaggacaagaccccggagacggcgacgagcgcggagcaggtg
gcggacttttacaacgcgcaggcgacgaagcaggagttcaacaacggcggggacgacgac
gagttttaa

DBGET integrated database retrieval system