KEGG   Micromonas pusilla: MICPUCDRAFT_30055Help
Entry
MICPUCDRAFT_30055 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mpp  Micromonas pusilla
Pathway
mpp00020  Citrate cycle (TCA cycle)
mpp00190  Oxidative phosphorylation
mpp01100  Metabolic pathways
mpp01110  Biosynthesis of secondary metabolites
mpp01200  Carbon metabolism
Module
mpp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mpp_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MICPUCDRAFT_30055
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MICPUCDRAFT_30055
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MICPUCDRAFT_30055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 Lycopene_cycl DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 9689187
NCBI-ProteinID: XP_003063914
JGI: 30055
UniProt: C1N7J8
LinkDB All DBs
AA seq 640 aa AA seqDB search
MSARKILGAAARAVGARMGGAPAPSTWTRPAACGFATSASAGANKPAYQIIDHEYDAVVV
GAGGAGLRAAIGLSEHGLKTACVTKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTI
KGADWLGDQDAIQYMCREAPKAVIELENYGLPFSRTDDEKIYQRAFGGQSLDYGRGGQAY
RCACAADRTGHAMLHTLYGQALKHDTQFFVEYFALDLIMDRGECVGVVAMCMEDGTIHRF
RSHKTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLI
TEGSRGEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLH
LNHLPPEILAERLPGISETAAIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKGEVLTIGSD
GNPDTVVPGLLAAGECASASVHGANRLGANSLLDIVVFGRACANTVSETLKPGMPHRKLA
SDFGEHAIAHLESVRSASGAHSTASVRKAMQRVMQDDAAVFRTQETLAEGCVKIDEVASR
LEDLDVTDKSLVWNTDLIEALELHNLMPNAQITMHSAEQRKESRGAHAREDFPNRDDVSW
MKHTLGFVDEKRKVKIDYRPVHSQPLDDEMEHVPPKARVY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcacgcaagatcctcggcgccgcggcgcgggccgtgggcgcgcgcatgggcggc
gcgcccgcgccgtccacctggacgcgccccgccgcgtgcgggttcgcgacctcggcgtcg
gcgggcgccaacaagcccgcttaccagatcatcgaccacgagtacgacgccgtcgtcgtc
ggcgccggcggcgccggtctgcgcgccgcgatcggcctcagcgagcatggcctgaagacg
gcgtgcgtcaccaagctgttcccgacgcgctcgcacacggtcgccgcgcagggcggcatc
aacgccgcgctcgggaacatgaccgaggacgactggcgctggcacgcgtacgacacgatc
aagggcgcggactggctcggggaccaagacgcgatccagtacatgtgccgcgaggcgccc
aaggcggtgatcgagctcgaaaactacggcctgccgttctcgagaaccgacgacgagaaa
atctatcagcgcgcgttcggaggccagagcctcgattacggcagaggcgggcaagcgtac
cgctgcgcgtgcgcggcggaccggaccgggcacgcgatgttgcacacgctgtacggccaa
gcgctgaagcacgacacgcagtttttcgtagagtacttcgcgctcgacctcatcatggac
cgaggcgagtgcgtcggcgtcgtcgcgatgtgcatggaggacgggacgatccatcggttc
cgatcgcacaagacgatcctcgcgaccggcgggtacggccgcgcgtacttcagcgccacg
agcgcgcacacgtgcaccggggacgggaacgcgatggtggcgcgcgcgggtttgccgctg
caagacctcgagttcgtgcagttccacccgacggggatctacggcgccgggtgcttgatc
accgagggaagccgcggcgagggcgggatcctgcgcaacagcgagggcgagcggttcatg
gagcggtacgcgccgacggcgaaagatctcgcgtcgagagacgtcgtgtcgaggtcgatg
acgatggagattcgcgaagggcgcggcgtcggcccggagaaggaccacatctacctccac
ctcaaccacctcccgcccgagattctcgcggagaggctcccgggcatctcggagaccgcc
gcgatcttcgcgggcgtggacgtcacgaaagaacccatccccgtgatccccaccgtgcac
tacaacatgggagggatccctaccaactacaagggcgaagtcctcaccatcgggtcggac
ggaaaccccgacaccgtggtgcccggtttactcgccgccggcgagtgcgcgtccgcgtcg
gtgcacggcgcgaaccgcctcggcgcgaactcgctcctggacatcgtcgtcttcggccgc
gcgtgcgcgaacacggtgtcggagacgctgaagcccgggatgccgcaccggaagctcgcg
agcgatttcggcgagcacgccatcgcgcacttggagtcggttcgaagcgcgagcggcgcg
cactccacggcgtcggtgcgaaaggcgatgcagcgcgtcatgcaggacgacgccgcggtg
ttccgcacgcaggagacgctcgcggaggggtgcgtcaagattgacgaggtggcgtcacgg
ttggaggacctcgacgtcacggacaaatctctggtgtggaacacggacttgatcgaggcg
ctcgagctgcacaacctgatgccgaacgcgcagatcacgatgcacagcgcggagcagcgc
aaggagtcgcgaggcgcgcacgcgcgggaggatttcccgaatcgcgacgacgtgagttgg
atgaagcacacgctcgggttcgtggacgagaagcggaaagtcaagatcgactaccgcccc
gtgcactcgcagccgctggacgacgagatggaacacgtcccgcccaaggcgcgggtgtac
taa

DBGET integrated database retrieval system