KEGG   Micromonas pusilla: MICPUCDRAFT_36200Help
Entry
MICPUCDRAFT_36200 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mpp  Micromonas pusilla
Pathway
mpp04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MICPUCDRAFT_36200
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MICPUCDRAFT_36200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu SEEK1
Motif
Other DBs
NCBI-GeneID: 9688567
NCBI-ProteinID: XP_003062923
JGI: 36200
UniProt: C1N584
LinkDB All DBs
AA seq 211 aa AA seqDB search
MMAATTTCTFTTAARHVCGANCACARASLSAKAFTPRASPGRAASLVVRAADEKKAVCVL
TGTAGVEGTVTFTQSGDGPTKIVGDISGLAEGLHGFHIHEFGDTTNGCMSTGPHFNPNGM
THGAPTDEIRHAGDMGNVTATKDGCAFEIEDAQIPLSGANTIVGRACVIHELEDDLGTGD
HSEPGTQGKTSKTTGNAGGRLACGVIGLTPN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgatggccgccacgacgacctgcacgttcacgaccgccgcccgccacgtctgcggcgcg
aactgcgcgtgcgctcgcgcgtcgctctccgcgaaggcgttcaccccgcgcgcatccccg
ggccgcgccgcctccctcgtcgtccgcgccgcggacgagaagaaggcggtctgcgtcctc
accggcaccgccggcgtcgagggcaccgtgacgttcacgcagtcgggcgacggccccacg
aaaatcgtcggcgacatctccggcctcgccgagggcctccacgggttccacatccacgag
ttcggcgacaccacgaacggctgcatgtccacggggccgcacttcaacccgaacgggatg
acgcacggcgcgccgacggacgagatccgtcacgcgggagacatgggcaacgtgacggcg
accaaggacgggtgcgcgtttgagatcgaggacgcgcagattcccctctcgggcgccaac
acgatcgtcggccgcgcgtgcgtgatccacgagctcgaggacgacctcggcacgggcgat
cactccgagcccgggacgcaggggaagacgagcaagacgacgggcaacgccggcggaagg
ctcgcgtgcggcgtcatcggcctcaccccgaactaa

DBGET integrated database retrieval system