KEGG   Micromonas pusilla: MICPUCDRAFT_49502Help
Entry
MICPUCDRAFT_49502 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
mpp  Micromonas pusilla
Pathway
mpp03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mpp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    MICPUCDRAFT_49502
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpp03036]
    MICPUCDRAFT_49502
   03400 DNA repair and recombination proteins [BR:mpp03400]
    MICPUCDRAFT_49502
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     MICPUCDRAFT_49502
Chromosome and associated proteins [BR:mpp03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    MICPUCDRAFT_49502
DNA repair and recombination proteins [BR:mpp03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MICPUCDRAFT_49502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD
Motif
Other DBs
NCBI-GeneID: 9682626
NCBI-ProteinID: XP_003056719
JGI: 49502
UniProt: C1MNX3
LinkDB All DBs
AA seq 348 aa AA seqDB search
MTDDGLTEYERQRLAHVARNREYMARLGVLDLAATIAPPEPTNRAKRKAKRPPTEPTRRS
GRVRNVKPEHDGSAVDALMDDEDVGGRRAKARRRARRDDDDDDDDDVDDDDVRIATGPAG
AGVWSSEQAALEASTRWLEDARALMLARTASIAPKGGGKLTNVGARDAWRSEAVRRWGKG
VPAADAVSDWEKWVTSRIGTPPPPSDLQLLQEYYAHDAWQLLVACVLMSRVSSWECKHNT
ISAFFAKYPTPTAALAAKPNDVLEVIRPLGLFPNRFRSVVEISAKILTEAGPLDVGPDQE
RKIYGVGEFGIDSFNVFCRGDLSVNPGDKTLQSFVNWQRRRGHEKKKK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgacgggctcacggagtacgagcgccagaggctcgcgcacgtcgcgaggaac
agagagtacatggcgcgcctgggcgtgctcgatctcgcggcgacgatcgcgcctcctgag
ccgacgaatcgcgcgaagcgcaaggcgaagcgcccgccgacggagccgacgcgccgcagc
gggcgcgtgcggaacgtcaagcccgagcacgacggcagcgcggtggacgcgctgatggac
gacgaggacgtcggcgggaggcgcgccaaggcgaggcggcgcgcgaggcgagacgacgac
gacgacgacgacgacgatgtcgacgacgacgacgttcgaatcgcgacgggccccgcgggc
gcgggcgtgtggtcgagcgagcaggccgcgctcgaggcgtcgacgcggtggctcgaggac
gcgcgcgcgctcatgctcgcgcggacggcgtccatcgcgccgaagggagggggtaagctc
acgaacgtcggcgcgagggacgcgtggaggtcggaggcggtgcgccgatgggggaagggc
gtgcctgccgccgacgcggtgtccgattgggagaaatgggtgacgtcgcgcatagggacg
ccgccgccgccgagcgatctgcagctgttgcaggagtactacgcgcacgacgcgtggcag
ctcctcgtcgcgtgcgtgctcatgtccagggtttcgagctgggagtgcaagcacaacacg
atcagcgcgttcttcgcgaagtaccccacgcccacggccgcgctcgcggcgaaaccgaac
gacgtcctcgaagtcatccgaccgctcgggctcttcccgaaccggttccgatccgtcgtg
gagatcagcgcgaagatactcactgaggcggggccgctcgacgtcgggccggaccaggag
cggaagatctacggcgtcggcgagttcgggatcgactcgttcaacgtgttctgtcgcggg
gatctgagcgtcaacccgggggataagacgttgcagtcgttcgtgaactggcagagacgc
cgcggccacgagaaaaagaaaaaataa

DBGET integrated database retrieval system